DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and AT2G35580

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_181101.1 Gene:AT2G35580 / 818123 AraportID:AT2G35580 Length:374 Species:Arabidopsis thaliana


Alignment Length:393 Identity:108/393 - (27%)
Similarity:184/393 - (46%) Gaps:79/393 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DLYQLLAKENADKNLITSPLSVEIALSLAYMGARG--KTAQEMRDVLKLPDDKKEVAAKFKDLLS 82
            ||.:.:..:|.....:|:|| :.:.||:....:.|  .||.::..:|:.....|..|...:.:.:
plant    16 DLKESVGNQNDIVLRLTAPL-INVILSIIAASSPGDTDTADKIVSLLQASSTDKLHAVSSEIVTT 79

  Fly    83 KLEGRESVA----ILSLANRIYVNNKFKLVPEYNQMVKDSFKA-------EAEAISANNPKITAS 136
            .|  .:|.|    .:|.||.:::.....:.|.:..::.:|:||       ..:|...|..     
plant    80 VL--ADSTASGGPTISAANGLWIEKTLNVEPSFKDLLLNSYKAAFNRVDFRTKADEVNRE----- 137

  Fly   137 IVNKWVDTQTSGKIRDLVMPSDVANLVL---VILNAIYFKGQWQKKFNTEQTK-SDFHISDQKSV 197
             ||.||:.||:|.|.:| :||:..:..|   :..||::|.|:|..:|:...|| ||||:.|...|
plant   138 -VNSWVEKQTNGLITNL-LPSNPKSAPLTDHIFANALFFNGRWDSQFDPSLTKDSDFHLLDGTKV 200

  Fly   198 PVQMMSLVRPFGVS------YDRELGANVIELPYR-----NSNLSMVIFLPDKVDGLPELEKKMV 251
            .|..|:     |.|      |:   |..||.|.||     :.:.||.|:|||:.||||.:.:::.
plant   201 RVPFMT-----GASCRYTHVYE---GFKVINLQYRRGREDSRSFSMQIYLPDEKDGLPSMLERLA 257

  Fly   252 ---GF------TPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHV 307
               ||      .|....:...|::|:||.:|:....:.|...|:.                 ..:
plant   258 STRGFLKDNEVLPSHSAVIKELKIPRFKFDFAFEASEALKGFGLV-----------------VPL 305

  Fly   308 GGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPP---MDFNVNHPFAYVIRDAEN--IYFQGHF 367
            ..::||:.:||:|.||:||||.|  ||....|.||   .||..:|||.:::::..:  :.|.|..
plant   306 SMIMHKSCIEVDEVGSKAAAAAA--FRGIGCRRPPPEKHDFVADHPFLFIVKEYRSGLVLFLGQV 368

  Fly   368 VNP 370
            ::|
plant   369 MDP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 107/391 (27%)
AT2G35580NP_181101.1 plant_SERPIN 8..371 CDD:238998 107/391 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.