DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina7

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_112390.1 Gene:Serpina7 / 81806 RGDID:619833 Length:426 Species:Rattus norvegicus


Alignment Length:376 Identity:103/376 - (27%)
Similarity:181/376 - (48%) Gaps:24/376 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVL--KLPDDK-KEV 73
            |::..|...||:.|:.||.|.|:..||:|:..||::...|:...|..::.:||  .|.|.. ||:
  Rat    55 SINADFAFRLYRKLSVENPDLNIFFSPVSISAALAMLSFGSGSSTQTQILEVLGFNLTDTPVKEL 119

  Fly    74 AAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITASIV 138
            ...|:.|:..|....:...|.:.|.:::..:.|.:.::...||..::.|..:...:|.......:
  Rat   120 QQGFQHLICSLNFPNNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHEI 184

  Fly   139 NKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQTK--SDFHISDQKSVPVQM 201
            |.:|:.||.|||..|:....: |::::::|.|:||.||...|...:|:  |:|.:....:|.|.|
  Rat   185 NSYVEKQTKGKIVGLIQDLKL-NIIMILVNYIHFKAQWANPFRVSKTEESSNFSVDKSTTVQVPM 248

  Fly   202 MSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGFTPKLININ----- 261
            |..:..:....|.||...|:::.|  |..::.:|:..|...:..:|..|...|.|..|..     
  Rat   249 MHQLEQYYHYVDVELNCTVLQMDY--SANALALFVLPKEGHMEWVEAAMSSKTLKKWNHLLQKGW 311

  Fly   262 VHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAA 326
            |.|.:|||.|..:..|...|..||::|||..||||..:..::|..:....|||.|.:.|||::..
  Rat   312 VELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITKDNGLKLSYAFHKAVLHIGEEGTKEG 376

  Fly   327 AATAVVFRYKSIRSP---PMD--FNVNHPFAYVI--RDAENIYFQGHFVNP 370
            |:...    .|:..|   |:.  ..::..|..:|  :...::.|.|..|:|
  Rat   377 ASPEA----GSLDQPEVAPLHAVIRLDRTFLLMILEKRTRSVLFLGKVVDP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 101/372 (27%)
Serpina7NP_112390.1 serpinA7_TBG 48..425 CDD:381023 103/376 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.