DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and zgc:173729

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001103200.1 Gene:zgc:173729 / 798311 ZFINID:ZDB-GENE-071004-64 Length:439 Species:Danio rerio


Alignment Length:442 Identity:139/442 - (31%)
Similarity:224/442 - (50%) Gaps:89/442 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVL----------- 64
            ::.:.:|:.:|::.::..||..|:..||:|:..||::..:||:|.||.:|..||           
Zfish     5 SAANTQFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNNPPKPGGA 69

  Fly    65 --------------------------------KLPDDKK--------------EVAAKFKDLLSK 83
                                            :||.|.|              ::.:.|...:|:
Zfish    70 TPTPAQATQKPQITCGVKSQHEPQALQQPQKFELPADLKKCPAQPVPGQKAEEQIHSSFNKFMSE 134

  Fly    84 LEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITASI-VNKWVDTQTS 147
            |....:..:||||||:|....::.:.::....|..:.|..|.:...|....:.: :||||:..|.
Zfish   135 LNKPGAPYVLSLANRLYGEQTYQFLEKFLSDAKTYYAAGLEKVDFKNKSEASRVNINKWVEKNTQ 199

  Fly   148 GKIRDLVMPSDVANLV--LVILNAIYFKGQWQKKFNTEQTK-SDFHISDQKSVPVQMMSLVRPFG 209
            .||:|| :||...:.:  ||::|||||||.|:|||..|.|: ..|.::..::.||:||.....|.
Zfish   200 EKIKDL-LPSGAIDAMTRLVLVNAIYFKGNWEKKFTKEATRDGQFKLNKNQTKPVKMMHQKARFS 263

  Fly   210 VSYDRELGANVIELPYRNSNLSMVIFLPDKVD----GLPELEK-----KMVGFT-PKLI-NINVH 263
            ::...|:.:.|:||||...||||:|.|||:::    ||.:|||     |::.:| |.:: ...|.
Zfish   264 LASIPEMNSQVLELPYAGKNLSMLIILPDQIEDATTGLQKLEKALTYEKLMEWTKPSMMCQQEVQ 328

  Fly   264 LRLPKFKIEFSARLEQVLIAMGIQDAFKTS-------ADFNDLVANSGAHVGGVVHKAFLEVNEE 321
            :.|||||.|.:..::.:|::||::|.|...       :..||||.:.      |:||||:|||||
Zfish   329 VSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSK------VIHKAFVEVNEE 387

  Fly   322 GSEAAAATAVVFRYKSI-RSPPMDFNVNHPFAYVIR--DAENIYFQGHFVNP 370
            |:||||||.|:....|: .|||..|..:|||.:.||  ....|.|.|.|.:|
Zfish   388 GTEAAAATGVIATLTSMPLSPPKTFTADHPFIFFIRHNPTNAILFYGRFSSP 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 138/437 (32%)
zgc:173729NP_001103200.1 SERPIN 4..439 CDD:294093 138/440 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3432
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8430
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.