DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpind1

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:388 Identity:108/388 - (27%)
Similarity:192/388 - (49%) Gaps:50/388 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VSCRFTDDLYQLLAKE-NADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPD-----DKK 71
            ::.:|..:||::|..: .:..|:..:|:.:..|:.:..:|.||:|.:|:..||...|     .|.
  Rat   109 LNAKFAFNLYRVLKDQATSSDNIFIAPVGISTAMGMISLGLRGETHEEVHSVLHFKDFVNASSKY 173

  Fly    72 EVAA---KFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKI 133
            ||..   .|:.|..:|..|.....|...|.:|:..:|.:..::...:::.:.|||:....::|..
  Rat   174 EVTTIHNLFRKLTHRLFRRNFGYTLQSVNDLYIQKQFPIREDFKAAMREFYFAEAQEADFSDPAF 238

  Fly   134 TASIVNKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKSV 197
             .|..|..:...|.|.|::.:..:|.|. .::|||.|||||.|..||..|.|.: :|.:::::.|
  Rat   239 -ISKANSHILKLTKGLIKEALENTDSAT-QMMILNCIYFKGAWMNKFPVEMTHNHNFRLNEREVV 301

  Fly   198 PVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGFTPKLI---- 258
            .|.||.....|..:.|:||..::::|.| ...:||:|.:|.|:.|:..||.::   ||:::    
  Rat   302 KVSMMQTKGNFLAANDQELDCDILQLEY-VGGISMLIVIPRKLSGMKTLEAQL---TPQVVERWQ 362

  Fly   259 ----NINVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGV--------- 310
                |....:.|||||:|.:..|.:||.:|||...|           |...::.|:         
  Rat   363 KSMTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLF-----------NKNGNMSGISDQRIIIDL 416

  Fly   311 -VHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAEN--IYFQGHFVNP 370
             .|::.:.|||||::|||.|.|.|...|.:   :.|.|:.||.:::.:...  :.|.|...||
  Rat   417 FKHQSTITVNEEGTQAAAVTTVGFMPLSTQ---VRFTVDRPFLFLVYEHRTSCLLFMGRVANP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 106/385 (28%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 108/388 (28%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.