DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina9

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001348839.1 Gene:Serpina9 / 71907 MGIID:1919157 Length:418 Species:Mus musculus


Alignment Length:380 Identity:112/380 - (29%)
Similarity:192/380 - (50%) Gaps:26/380 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ATSVS---CRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLP---D 68
            |:.||   .||:..|||.||:||..:|::.||:|:..:|::..:|||..|..::...|...   .
Mouse    43 ASQVSPSNTRFSFLLYQRLAQENPGQNILFSPVSISTSLAMLSLGARSATKTQILRTLGFNFTWV 107

  Fly    69 DKKEVAAKFKDLLSKL----EGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISAN 129
            .:..:...|:.|:..|    :|||    |.:.:.:::..:.:|...:...||..:.|:..:...:
Mouse   108 SEPTIHMGFEYLVRSLNKCHQGRE----LRMGSVLFIRKELQLQATFLDRVKKLYGAKVFSEDFS 168

  Fly   130 NPKITASIVNKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQTKSDFH--IS 192
            |.....:.:|.:|:.:|.||:.|::...| :...:|::|.|:||..|.:.|:|..|...|.  :|
Mouse   169 NAATAQAQINSYVEKETKGKVVDVIQDLD-SQTAMVLVNHIFFKANWTQPFSTANTNKSFPFLLS 232

  Fly   193 DQKSVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVG----- 252
            ...:|.|.||.....|....|:|||.:::::.||...::..: ||.| ..:.:|||.:..     
Mouse   233 KGTTVHVPMMHQTESFAFGVDKELGCSILQMDYRGDAVAFFV-LPGK-GKMRQLEKSLSARRLRK 295

  Fly   253 FTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLE 317
            ::..|....:.:.:|||.|..|..||.:|..|||:|||.::|||:.:.......|....|||.|:
Mouse   296 WSRSLQKRWIKVFIPKFSISASYNLETILPKMGIRDAFNSNADFSGITKTHFLQVSKAAHKAVLD 360

  Fly   318 VNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRD--AENIYFQGHFVNP 370
            |:|||:||||||......:|..:|........||..::.|  .|::.|.|...||
Mouse   361 VSEEGTEAAAATTTKLIVRSRDTPSSIIAFKEPFLILLLDKNTESVLFLGKVENP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 108/374 (29%)
Serpina9NP_001348839.1 alpha-1-antitrypsin_like 49..412 CDD:239011 107/369 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.