DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpine3

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:400 Identity:97/400 - (24%)
Similarity:168/400 - (42%) Gaps:54/400 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLLATSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDK 70
            |.||.|    .|...|||..|.|....|.:.||.||.::|.:....|||.|..::.:.|......
  Rat    28 LWLLKT----EFALHLYQSAAAETNGTNFVISPASVSLSLEILQFAARGNTGWQLAEALGYTVQD 88

  Fly    71 KEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITA 135
            ..|......:...|........:.||..:::.....|.|.:.:.|.....:..|....:.|..|.
  Rat    89 PRVREFLHTVYITLHNSSQGIGMELACTLFMQTGTSLSPCFVEQVSRWANSSLELADFSEPNTTT 153

  Fly   136 SIVNKWVDTQTSGK--IRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQTKSDFHISDQKSVP 198
            ...:|.....::|:  ...|...:...:..|.|::.:.|:..||::|:              ||.
  Rat   154 MEASKGTTRPSTGEGPGSPLWGRAGALSTQLSIVSTMTFQSSWQQRFS--------------SVA 204

  Fly   199 VQMMSLVRPFG-------------VSYDRELGA-----NVIELPYRNSNLSMVIFLP-DKVDGLP 244
            :|.:......|             |||.:...|     :|:||.|.....|:::.|| ||...|.
  Rat   205 LQPLPFTCAHGLVLQVPAMHQVAEVSYGQFQDAAGHKVDVLELLYLGRVASLLLVLPQDKGTPLD 269

  Fly   245 ELEKKMVG-----FTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLVANS 303
            .:|..:..     :|.:|....:.:.||:|:|:....|:.:|.:.||.|.| ...|:...:....
  Rat   270 HIEPHLTARVIHLWTTRLKRARMDVFLPRFRIQNQFDLKSILRSWGITDLFDPLKANLKGISGRD 334

  Fly   304 GAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAENIYFQ---- 364
            |.:|..|.|||.:|::|||:::.|||||:...:| |:|.  |..:.||.:::|:...:..:    
  Rat   335 GFYVSEVTHKAKMELSEEGTKSCAATAVLLLRRS-RTPA--FKADRPFIFLLREHNTVAVRITHG 396

  Fly   365 --GHFVNPEL 372
              .:|:|.:|
  Rat   397 KVANFLNFQL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 91/388 (23%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 94/392 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.