DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina1f

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:412 Identity:92/412 - (22%)
Similarity:181/412 - (43%) Gaps:61/412 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCLLLLATSVS----------------------CRFTDDLYQLLAKENADKNLITSPLSVEIALS 46
            ||.|||.|...                      |..:..|::.:|:.:.:.|::.||:.|..|:|
Mouse    16 LCCLLLITKTKHEKLYEDPSIDPFQCRKVALTICNVSITLFKKMAQLSGNGNILFSPIRVIAAIS 80

  Fly    47 LAYMGARGKTAQEMRDVLK-----LPDDKKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFK 106
            :..:|:.|..::.:.:.|:     ||:  .|:...|..||..:...|..:.|...:.::::....
Mouse    81 MLSLGSNGNLSKHILETLRFNKTGLPE--AEIHKCFWYLLHSIHQTEEPSSLQTGSSVFIHQDLT 143

  Fly   107 LVPEYNQMVKDSFKAEAEAISANNPKITASIVNKWVDTQTSGKIRDLV--MPSDVANLVLVILNA 169
            .|.::.:.|||.:.::..:|:..:.....:.:|.:|..::..:|.::|  :.||.   .|.::|.
Mouse   144 SVDKFVKGVKDLYHSDMISINFTDSSQAKTQINNYVMEKSQKEIVNIVKNLESDT---FLAVVNY 205

  Fly   170 IYFKGQWQKKFNTEQTK-SDFHISDQKSVPVQM---MSLVRPFGVSYDRELGANVIELPYRNSNL 230
            |.:..:....|.....| .|:|:....::.|.|   |::...|.|   .:|.:.|:.|.....|.
Mouse   206 IIWNAKLDSNFGCRSVKVKDYHLGYGMTIKVPMIHNMAMHYLFRV---EDLSSTVLMLTLLTGNF 267

  Fly   231 SMVIFLPDKVDGLPELEKKMV-----GFTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAF 290
            :....:||. ..:.::|:.:.     ....:|:...|.|.:|:..:..:..||.::..:||...|
Mouse   268 ATYFIIPDP-GKMQKVEQSLTYPHFRRMRRQLLTRLVDLEIPELSLSETHDLESMMSLLGITYVF 331

  Fly   291 KT---SADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMD-FNVNHPF 351
            .:   |:|.||.:..|..    ||.||.|.::|:||:.:..:.    :|.:.|..|. ..:|.||
Mouse   332 NSGTNSSDMNDTLQKSFK----VVSKAVLTIDEKGSKPSTNSC----FKKLGSTDMGRMQLNRPF 388

  Fly   352 AYVIRDAEN--IYFQGHFVNPE 371
            ...|:|..|  ..|.|..|||:
Mouse   389 LIFIQDHTNDVPLFLGRVVNPQ 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 84/399 (21%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 84/377 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.