DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and SERPINE3

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001094790.1 Gene:SERPINE3 / 647174 HGNCID:24774 Length:424 Species:Homo sapiens


Alignment Length:419 Identity:102/419 - (24%)
Similarity:171/419 - (40%) Gaps:90/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKKEVA- 74
            |.:...|...|||.:|....:.|.:.||..|.:.|.:...||.|.|.|::.|.|......|.|. 
Human    27 TLLKTEFALHLYQSVAACRNETNFVISPAGVSLPLEILQFGAEGSTGQQLADALGYTVHDKRVKD 91

  Fly    75 ---AKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITAS 136
               |.:..|.:..:|.|    :.||..::|.....|.|.:.:.|.....:..|....:.|..||.
Human    92 FLHAVYATLPTSSQGTE----MELACSLFVQVGTPLSPCFVEHVSWWANSSLEPADLSEPNSTAI 152

  Fly   137 IVNKWVDTQTSGKIRDLVMPSD-----------VANLVLVILNAIYFKGQWQKKFNTEQTKSDFH 190
            ..::....:|:|.     .||:           .|...||:::.:.|:|.|:|:|::..|:    
Human   153 QTSEGASRETAGG-----GPSEGPGGWPWEQVSAAFAQLVLVSTMSFQGTWRKRFSSTDTQ---- 208

  Fly   191 ISDQKSVPVQMMSLVRPFGVSYDREL----------------------GANVIELPYRNSNLSMV 233
                          :.||..:|...|                      ...|:||||..|.:|:.
Human   209 --------------ILPFTCAYGLVLQVPMMHQTTEVNYGQFQDTAGHQVGVLELPYLGSAVSLF 259

  Fly   234 IFLP-DKVDGLPELEKKMVG-----FTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAF-K 291
            :.|| ||...|..:|..:..     :|..|....:.:.||:|:|:....|:.:|.:.|:.|.| .
Human   260 LVLPRDKDTPLSHIEPHLTASTIHLWTTSLRRARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDP 324

  Fly   292 TSADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIR 356
            ..|:...:....|.:|...:|||.:||.|||::|:.|||::...:| |.|  .|..:.||.|.:|
Human   325 LKANLKGISGQDGFYVSEAIHKAKIEVLEEGTKASGATALLLLKRS-RIP--IFKADRPFIYFLR 386

  Fly   357 DAE---NIYF-------------QGHFVN 369
            :..   .::|             :|.||:
Human   387 EPNTGITVFFDRIQIIYQCLSSNKGSFVH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 101/416 (24%)
SERPINE3NP_001094790.1 SERPIN 31..399 CDD:238101 98/397 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..174 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.