DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina3i

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_017170641.1 Gene:Serpina3i / 628900 MGIID:2182841 Length:457 Species:Mus musculus


Alignment Length:399 Identity:122/399 - (30%)
Similarity:185/399 - (46%) Gaps:46/399 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL------ 66
            |...|.:..|...||:.|..:|.|:|::.||.|:..||:|..:||:..|.:|:.:.||.      
Mouse    70 LTVASSNTDFAFSLYRKLVLKNPDENVVFSPFSIFTALALLSLGAKSNTLKEILEGLKFNLTETP 134

  Fly    67 -PDDKKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANN 130
             ||    :...|:.||..|........:|..:.::|....:::.|:.:..:..::|||.......
Mouse   135 EPD----IHQGFRYLLDLLSQPGDQVQISTGSALFVEKHLQILAEFKEKARALYQAEAFTADFLQ 195

  Fly   131 PKITASIVNKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFK--------------GQWQKKFN 181
            |.....::|.:|..||.|||::|:...|.:.| :|::|.||||              |:|:..|:
Mouse   196 PCQAKKLINDYVSNQTQGKIKELISDLDKSTL-MVLVNYIYFKGGRGHCLGVEREELGKWKMPFD 259

  Fly   182 TEQT-KSDFHISDQKSVPVQMM---SLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPD--KV 240
            ...| .|.|::.:::||.|.||   .|..|:  ..|.||..:|:||.| ..|.|.:..|||  |:
Mouse   260 PRDTFNSKFYLDEKRSVKVPMMKIEELTTPY--FRDDELSCSVVELKY-TGNASALFILPDQGKM 321

  Fly   241 DGL-----PE-LEKKMVGFTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDL 299
            ..:     || |.|......|..|:   .|.||||.|.....||.||..:||::.|...||.:.:
Mouse   322 QQVETSLHPETLRKWKNSLKPSRIS---ELHLPKFSISNDYSLEHVLPVLGIREVFSMQADLSAI 383

  Fly   300 VANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAEN--IY 362
            .......|..|||||.|:|.|.|:||||||.|....:..:...|......||..:|.|...  ..
Mouse   384 TGTMDLRVSQVVHKAVLDVTETGTEAAAATGVKVNLRCGKIYSMTIYFKRPFLIIISDINTHIAL 448

  Fly   363 FQGHFVNPE 371
            |.....||:
Mouse   449 FMAKVTNPK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 118/390 (30%)
Serpina3iXP_017170641.1 serpinA3_A1AC 62..457 CDD:381019 121/397 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.