DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and LOC569077

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001188383.1 Gene:LOC569077 / 569077 -ID:- Length:384 Species:Danio rerio


Alignment Length:384 Identity:146/384 - (38%)
Similarity:208/384 - (54%) Gaps:41/384 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKKEVAAKFKDLL 81
            |..||||.|:..:|:.|:..||||:...||:.|:||||.||.||..||.| ....:|.:.|:.|:
Zfish    11 FALDLYQALSASSAEGNIFFSPLSISAVLSMVYLGARGDTAAEMERVLSL-SSVSDVHSHFESLI 74

  Fly    82 SKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITAS-----IVNKW 141
            |.:....:..||.||||:|....|..:||........:.||.:.:..    |.||     ::|||
Zfish    75 SSINSPSASYILRLANRLYGEKSFSFLPECLDSTMKLYHAELQTVDF----IGASEGSRQLINKW 135

  Fly   142 VDTQTSGKIRDLVMPSDVANLV-LVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKSVPVQMMSL 204
            |:.||..|||||:.|..|..:. |.::|||||||:|...|..:.|:. .|.|:.::|.||:||..
Zfish   136 VEKQTENKIRDLLKPGMVTTMTRLALVNAIYFKGKWTHTFQAKYTREMAFKINQKESHPVRMMHQ 200

  Fly   205 VR--PFGVSYDRELGANVIELPYRNSNLSMVIFLPDKV----DGLPELEKKMVGFTPKLIN---- 259
            :.  ||....:.:|  .|:||||....|||:|.|||:.    |.|.:|||::.  ..||::    
Zfish   201 LNKLPFRCLPEYKL--QVLELPYIQQELSMLILLPDETKDGSDPLLKLEKELT--LEKLLDWTNR 261

  Fly   260 --------INVHLRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLVANSGAHVGGVVHKAF 315
                    :.||  |||||:|..:.|.:.|..||:...| :|.||...:.:|.|..|..|:||||
Zfish   262 DKMDTQGAVIVH--LPKFKLEIESCLSETLEKMGMSSVFQETKADLTGMGSNGGLFVSAVIHKAF 324

  Fly   316 LEVNEEGSEAAAATAV--VFRYKSIRSPPMDFNVNHPFAYVIR--DAENIYFQGHFVNP 370
            ::|:|||:||||||.|  :..|.....|...|..:|||.:.||  .:.||.|.|.:.:|
Zfish   325 VDVSEEGTEAAAATCVYIITSYVPRPEPRYYFTADHPFMFFIRHNPSNNILFLGRYRSP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 145/382 (38%)
LOC569077NP_001188383.1 SERPIN 5..383 CDD:294093 145/382 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.