DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and serpinh1a

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001103844.1 Gene:serpinh1a / 555328 ZFINID:ZDB-GENE-080219-21 Length:403 Species:Danio rerio


Alignment Length:400 Identity:96/400 - (24%)
Similarity:190/400 - (47%) Gaps:43/400 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCLLLLAT--------SVSCRFTD-------DLYQLLAKENADKNLITSPLSVEIALSLAYMGAR 53
            |.|.||||        |::....|       :|||.:||:...:|::.||:.|..:|.|..:|.:
Zfish     7 LLLCLLATVSANKTLSSIATTLADNSATLAFNLYQNMAKDKDIENILISPVVVASSLGLVALGGK 71

  Fly    54 GKTAQEMRDVLKLPDDKKE-VAAKFKDLLSKLEGRESVAIL-SLANRIYVNNKFKLVPEYNQMVK 116
            ..||.:::.||.....|.| :.:...:||:::...::..:. .::||.|..:....|.::.:..|
Zfish    72 SNTASQVKTVLSAASVKDEQLHSGLSELLTEVSNPKARNVTWKISNRFYGPSSVSFVDDFLKSSK 136

  Fly   117 DSFKAEAEAISANNPKITASIVNKWVDTQTSGKIRDL---VMPSDVANLVLVILNAIYFKGQWQK 178
            ..:..:...|:..:.:.....:|.|....|.||:.::   |..:|.|    :|:||:::|..|.:
Zfish   137 KHYNYDHSKINFRDKRSAVKAINDWASKSTDGKLPEVTKDVEKTDGA----MIINAMFYKPHWNE 197

  Fly   179 KFNTEQTKS-DFHISDQKSVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDG 242
            :|:.:...: .|.:....:|.|.||.....:|...|......|:|:|..:...|:|:.:|..|:.
Zfish   198 QFHHKMVDNRGFLVHRSFTVSVPMMHRTGIYGFLDDTTNKLLVLEMPLAHKMSSLVLIMPYHVES 262

  Fly   243 LPELEKKMVGFTPKLINI--------NVHLRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFND 298
            |..:||.:   |.:.:|.        .|.:.|||..:|.|..|::.|..:|:.:|. |..||.::
Zfish   263 LERVEKLL---TRQQLNTWVSAMEQKAVAISLPKVSMEVSHNLQKHLAELGLTEAVDKAKADLSN 324

  Fly   299 LVANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRD--AENI 361
            :......::..|.|.:.:|.:.||:....:   :|....:::|.: |..:|||.::::|  ..:|
Zfish   325 ISGKKDLYLSNVFHASAMEWDTEGNPPDTS---IFGTDQLKNPKL-FYADHPFVFLVKDNKTNSI 385

  Fly   362 YFQGHFVNPE 371
            .|.|..:.|:
Zfish   386 LFMGRLIRPK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 88/379 (23%)
serpinh1aNP_001103844.1 SERPIN 26..391 CDD:294093 88/375 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.