DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinb9h

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001357856.1 Gene:Serpinb9h / 544923 MGIID:3709608 Length:377 Species:Mus musculus


Alignment Length:369 Identity:121/369 - (32%)
Similarity:202/369 - (54%) Gaps:17/369 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL-PDDKKEVAAKFKDL 80
            |...|.::|.::|..||:..||:|:..||::..:||:|.||.::...|.| ||:  :|...|:.|
Mouse    11 FAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNPDE--DVHQGFQLL 73

  Fly    81 LSKLEGRESVA-ILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAIS-ANNPKITASIVNKWVD 143
            |..|..:.:.. .|::|||::|.|..:|:|.:.:.....:.:|.|.:| |...:.:...:|.||.
Mouse    74 LHNLNKQNNQKYCLTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEAAEESRQHINMWVS 138

  Fly   144 TQTSGKIRDLVMPSDV-ANLVLVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKSVPVQMMSLVR 206
            .||:|||.||:....| :...|::.||:||.|.|.|:|...:||. .|.|:.:::.|||||....
Mouse   139 KQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKETRPVQMMWRED 203

  Fly   207 PFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELE-----KKMVGFT-PKLIN-INVHL 264
            ....:|.:|:.|.|:.:||...:|:.|:.|||:...:.::|     :|:..:| |:.:| ...|:
Mouse   204 TLFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEFMNRTEFHV 268

  Fly   265 RLPKFKIEFSARLEQVLIAMGIQDAFKTS-ADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAAAA 328
            ..|||:::....:..:|..:||.:.|..| ||.:.:.......:...|||..:||||||:|||||
Mouse   269 YYPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGMSTKENLCLSEFVHKCVVEVNEEGTEAAAA 333

  Fly   329 TAVVFRYKSIRSPPMDFNVNHPFAYVIRDA--ENIYFQGHFVNP 370
            :||.|.:......|..|..:|||.:.|..:  .:|.|.|.|.:|
Mouse   334 SAVEFIFLCSGPDPETFCADHPFLFFIMHSTTNSILFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 120/367 (33%)
Serpinb9hNP_001357856.1 serpinB 7..374 CDD:381072 119/364 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44055
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.