DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and SERPINB13

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:399 Identity:127/399 - (31%)
Similarity:218/399 - (54%) Gaps:44/399 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKK--EVA 74
            :||.|...||::.|.|.| |.|:..||:.:..|:.:..:|.||.||.::.:|.....:.|  .:.
Human     6 AVSTRLGFDLFKELKKTN-DGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIK 69

  Fly    75 AKFKDLLS-KLEGRE---SVAI-------------------LSLANRIYVNNKFKLVPEYNQMVK 116
            |:.|:::. |.||:|   :.|:                   |::.||::....:..:.:|...|:
Human    70 AEEKEVVRIKAEGKEIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVE 134

  Fly   117 DSFKAEAEAIS-ANNPKITASIVNKWVDTQTSGKIRDLVMPSDVANLV-LVILNAIYFKGQWQKK 179
            ..:.|..|.:. .|....:...:|.||:::|:.||:||.....:::.. ||::|.:||||||.::
Human   135 KYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDRE 199

  Fly   180 FNTEQTKSD-FHISDQKSVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGL 243
            |..|.||.: |.::...|..||||:....|..::..:|.|.::.:||:|::|||.:.||:.:|||
Human   200 FKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGL 264

  Fly   244 PEL-----EKKMVGFTP--KLININVHLRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLV 300
            .::     .:|:|.:|.  .:....|:|.||:|::|....||.||.|||:.||| :..||::.:.
Human   265 EKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMS 329

  Fly   301 ANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNV--NHPFAYVIR--DAENI 361
            :.||.:....:|.:|:.|.|||:||||||.:.|   ::.|.|...||  ||||.:.||  ::.:|
Human   330 SGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGF---TVTSAPGHENVHCNHPFLFFIRHNESNSI 391

  Fly   362 YFQGHFVNP 370
            .|.|.|.:|
Human   392 LFFGRFSSP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 125/395 (32%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 126/397 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.