DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and SERPINA5

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:407 Identity:123/407 - (30%)
Similarity:195/407 - (47%) Gaps:47/407 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCLLLL----------------------------ATSVSCRFTDDLYQLLAKENADKNLITSPLS 40
            |||:||                            |.|....||.|||:.||.....:::..||:|
Human     7 LCLVLLSPQGASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQSIFFSPVS 71

  Fly    41 VEIALSLAYMGARGKTAQEMRDVLKL---PDDKKEVAAKFKDLLSKLEGRESVAILSLANRIYVN 102
            :.::|::..:||...|..::.:.|.|   ...:||:...|:.||.:|........|||.|.::.:
Human    72 ISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTD 136

  Fly   103 NKFKLVPEYNQMVKDSFKAEAEAISANNPKITASIVNKWVDTQTSGKIRDLVMPSDVANLVLVIL 167
            ....|...:...:|..:.|:....:..:.......:|.:|..||.|||.||:...| :|.|::::
Human   137 LVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLD-SNAVVIMV 200

  Fly   168 NAIYFKGQWQKKFNTEQT-KSDFHISDQKSVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLS 231
            |.|:||.:|:..||.:.| :.||:::.:..|.|.|||....:....||.|...|:.:||: .|.:
Human   201 NYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQ-GNAT 264

  Fly   232 MVIFLPDK------VDGLPE--LEKKMVGFTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQD 288
            .:..||.:      .:||.|  |.|.:..|..:    .:.|.||||.||.|.:||:||.::||.:
Human   265 ALFILPSEGKMQQVENGLSEKTLRKWLKMFKKR----QLELYLPKFSIEGSYQLEKVLPSLGISN 325

  Fly   289 AFKTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAY 353
            .|.:.||.:.:..:|...|..:||||.:||:|.|:.|||||..:|.::|.|........|.||..
Human   326 VFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLM 390

  Fly   354 VIRDAENIYFQGHFVNP 370
            .|.| .||.|.|....|
Human   391 FIVD-NNILFLGKVNRP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 115/367 (31%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 115/365 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.