DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Spn88Ea

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster


Alignment Length:403 Identity:125/403 - (31%)
Similarity:196/403 - (48%) Gaps:70/403 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL--PDDKKEVAAKFKD 79
            |...:..::.:...::|:..||.|...||.|||.|:.|.|.:|:..||.|  .|.|:.|.:.:  
  Fly    43 FAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAY-- 105

  Fly    80 LLSKLEGRESVAILSL----ANRIYVNN--------KFKLVPEYNQMVKDSFKAEAEAISANNPK 132
            :|.|:..:|..:.:.|    |:||:..|        :.:|..|..|:   .||::.|.       
  Fly   106 ILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLAEEVQQI---DFKSQTEE------- 160

  Fly   133 ITASIVNKWVDTQTSGKIRDLVMPSDVA-NLVLVILNAIYFKGQWQKKFNTEQT-KSDFHISDQK 195
             :...:|.|:..||..:||:::...::. ...||:.||.|.||||..:|.||:| ...|:.|...
  Fly   161 -SRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSN 224

  Fly   196 SVPVQMMSLVRPFGVSYDRELGANVIELPYR---------------NSNLSMVIFLPD------- 238
            ...|.||.....|.::.|.:|.|:|::||||               ||::|||:.||.       
  Fly   225 YSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLE 289

  Fly   239 ------KVDGLPELEKKMVGFTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTS-ADF 296
                  ..|.|.:..|:.:   |:.|.::    ||||:.|....|..:|..||:...|..| |.|
  Fly   290 DVLSRLNADSLDDSLKQAM---PREIEVS----LPKFEFEQRLELNPILAKMGVSKMFDESVATF 347

  Fly   297 NDLVANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRS-PPMDFNVNHPFAYVI--RDA 358
            :||.:.: ..:|...|.|.::|:||||.||||| |:|.|:|.|. .|..|..||||.:||  |.:
  Fly   348 DDLTSET-ISIGDSKHVAKIKVDEEGSTAAAAT-VLFTYRSARPVEPAKFECNHPFLFVIYDRTS 410

  Fly   359 ENIYFQGHFVNPE 371
            .:|.|.|.:.:|:
  Fly   411 RSILFTGIYRDPK 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 124/400 (31%)
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 124/397 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.