DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and SERPINC1

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens


Alignment Length:428 Identity:125/428 - (29%)
Similarity:200/428 - (46%) Gaps:77/428 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFTDDLYQLLA-KENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKKEVA 74
            :..:.||....||.|| .:|.:.|:..||||:..|.::..:||...|.|::.:|.|.....::.:
Human    84 SKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTS 148

  Fly    75 AKFKDLLSKLEGR------ESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAIS-ANNPK 132
            .:.....:||..|      :|..::| |||::.:........|..:.:..:.|:.:.:. ..|.:
Human   149 DQIHFFFAKLNCRLYRKANKSSKLVS-ANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKENAE 212

  Fly   133 ITASIVNKWVDTQTSGKIRDLVMPSDVAN--LVLVILNAIYFK---------------------- 173
            .:.:.:||||..:|.|:|.| |:||:..|  .|||::|.||||                      
Human   213 QSRAAINKWVSNKTEGRITD-VIPSEAINELTVLVLVNTIYFKVLRMALERPQGLPLALQLTPFF 276

  Fly   174 -------------------GQWQKKFNTEQTKSD-FHISDQKSVPVQMMSLVRPFGVSYDREL-G 217
                               |.|:.||:.|.|:.: |:.:|.:|....||.....|  .|.|.. |
Human   277 FKWRDRSPERANGLPKATQGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKF--RYRRVAEG 339

  Fly   218 ANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGFTPKLIN----------INVHLRLPKFKIE 272
            ..|:|||::..:::||:.||.....|.::||::   ||:::.          :.||  :|:|:||
Human   340 TQVLELPFKGDDITMVLILPKPEKSLAKVEKEL---TPEVLQEWLDELEEMMLVVH--MPRFRIE 399

  Fly   273 FSARLEQVLIAMGIQDAFK-TSADFNDLVA--NSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFR 334
            ....|::.|..||:.|.|. ..:....:||  ....:|....||||||||||||||||:||||..
Human   400 DGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEEGSEAAASTAVVIA 464

  Fly   335 YKSIRSPPMDFNVNHPFAYVIRDA--ENIYFQGHFVNP 370
            .:|:....:.|..|.||...||:.  ..|.|.|...||
Human   465 GRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRVANP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 123/423 (29%)
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 125/428 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.