DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinb6e

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001039000.2 Gene:Serpinb6e / 435350 MGIID:2667778 Length:429 Species:Mus musculus


Alignment Length:375 Identity:127/375 - (33%)
Similarity:210/375 - (56%) Gaps:29/375 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDK-----KEVAAK 76
            ||..|:::|. |::.||:..|..|:..:|:|..|||.|.||.::..||.|  ||     .:|...
Mouse    63 FTLKLFRVLG-EDSSKNVFFSSSSMFSSLALILMGANGTTASQISQVLSL--DKCSNGGADVQQG 124

  Fly    77 FKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAIS-ANNPKITASIVNK 140
            |:.||:::...::..:|..||:|:.:|.|.::..:.:.....::.|.|.:. ...|:.....:|.
Mouse   125 FQSLLTEVNKTDTGHMLRRANKIFSDNNFDIMESFKESCYKLYRVEIEKLDFKGTPEQCRQHINA 189

  Fly   141 WVDTQTSGKIRDLVMPSDV-ANLVLVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKSVPVQMMS 203
            ||..:|...||:|:....| :|..|:::||.||||:|:|:||.|.|:. .|.:|..:...|||||
Mouse   190 WVAKKTKDVIRELLSLYTVNSNTRLILVNATYFKGKWEKQFNKEDTREMPFKVSKNEKKTVQMMS 254

  Fly   204 LVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELE-----KKMVGFTPKLINI--- 260
            ....|...|..|:...::.|||.:..|||:|.|||:...|..:|     ||::.:| :|:.:   
Mouse   255 KKSTFKTYYAEEISTTIVFLPYTDKELSMIIMLPDEQVELSMVENQISYKKLIQWT-RLVKMEEE 318

  Fly   261 NVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTS-ADFNDLVANSGAHVGGVVHKAFLEVNEEGSE 324
            .|.:.||:||:|.:..::.||..:|:.|||:.| |||:.:.:..|..:..||||:|:||||||:|
Mouse   319 EVQVFLPRFKLEATYDMKDVLCKLGMTDAFEESRADFSGISSKKGLFLSNVVHKSFVEVNEEGTE 383

  Fly   325 AAAATAVVFRYKSIRSPPMD--FNVNHPFAYVIR--DAENIYFQGHFVNP 370
            ||.||.:|    ::.||...  ...:.||.::|:  .::.|.|.|.|.:|
Mouse   384 AAVATEIV----TVGSPLTQRCLIADRPFLFLIQGDKSKEILFLGRFSSP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 126/373 (34%)
Serpinb6eNP_001039000.2 serpin 53..429 CDD:393296 126/373 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44055
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.