DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Spn77Ba

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster


Alignment Length:377 Identity:101/377 - (26%)
Similarity:177/377 - (46%) Gaps:29/377 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTDDLYQLLA--KENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKKEVAAKFKD 79
            |..||.|.::  .|.|:|:.:.||.||...|.|.|.|:.|:|..:::..|::..:.:::...:|.
  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKV 143

  Fly    80 LLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITASIVNKWVDT 144
            ..|.|....|...::....||....:.:...|...:: ::..:...:...:|.....| |:..:.
  Fly   144 WSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQ-NYNVQPMEVDFYSPDSVIQI-NEDTNR 206

  Fly   145 QTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQTKSDFHISDQKSVPVQMMSLVRPFG 209
            .|.|.|...::|.||....:.:|:::||||||:..||...|:.:...|:...|..::..:|:...
  Fly   207 TTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEAN 271

  Fly   210 VSYDRE---LGANVIELPY-RNSNLSMVIFLPD------------KVDGLPELEKKMVGFTPKLI 258
            .:|...   |...|:|||| ....|:|::.||.            |..||..:.:::..|..:..
  Fly   272 FAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRAS 336

  Fly   259 NIN-VHLRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLVANSGAHVGGVVHKAFLEVNEE 321
            ..| |.:.:|||.......|:.|||.|||:|.| :.:|:.:.:  :||.....|||...:.|:|:
  Fly   337 EDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRM--SSGLFAKLVVHSTKIIVDEQ 399

  Fly   322 GSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAEN--IYFQGHFVNPE 371
            |:.|.|.|......|:  :|| .|.:|.||.|:|.:...  :.|.|...||:
  Fly   400 GTTAGAVTEAALANKA--TPP-KFLLNRPFQYMIVEKATGLLLFAGQVRNPK 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 99/374 (26%)
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 99/371 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
54.950

Return to query results.
Submit another query.