DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and serpine2

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_956478.1 Gene:serpine2 / 393153 ZFINID:ZDB-GENE-040426-848 Length:395 Species:Danio rerio


Alignment Length:398 Identity:122/398 - (30%)
Similarity:196/398 - (49%) Gaps:48/398 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLATSVS--------CRFTD---DLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEM 60
            ||.:.|||        .|.:|   .::..:.::.|.:|::.||..|...|.:...||.|.|.:::
Zfish    12 LLCSVSVSQSQSSSYGARGSDLGLQVFMQVLQDRAQENVLLSPHGVASVLGMLLPGAHGDTRRQL 76

  Fly    61 RDVLKLPDDKKEVAAK-FKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAE 124
            .:.||.   ||....| .:.|...|..:.:..|:::||.::.|..|.:..::....:::|..|:.
Zfish    77 LNGLKY---KKNGPYKMLRKLHKSLTTKSNADIVTIANALFPNEGFSMKEDFLSANRENFLCESH 138

  Fly   125 AISANNPKITASIVNKWVDTQTSGKIRDLVMPS--DVANLVLVILNAIYFKGQWQKKFNTEQTK- 186
            ::..::|:..|..:|.||...|.|:|..:|...  |.|...||.:|:|:|||.|:.:|..:.|| 
Zfish   139 SVDYSDPEAAAQSINDWVKNSTKGQIPSVVTADMFDTALTRLVAVNSIFFKGLWKSRFQPQSTKP 203

  Fly   187 SDFHISDQKSVPVQMMSLV---------RPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDG 242
            ..|...|..:..|.|||.:         .|.|..|      .||||||..:::||.|.||.: |.
Zfish   204 RSFTAGDGNTYKVPMMSQLSVFNMGQASTPDGQKY------IVIELPYHGNSMSMFIALPTE-DS 261

  Fly   243 ------LPELEKKMVGFTPKLIN-INVHLRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDL 299
                  ||.:....:....||:| ..:.|.:|||.:|....||..|.|:||:|.| :..|||..|
Zfish   262 TPLSSILPHISTNTIQSWTKLMNPRRMRLLMPKFTVEQELDLETPLKALGIKDIFDQNKADFRHL 326

  Fly   300 VANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIR--DAENIY 362
            .:.| .:|...:.||.:||||:|::|:|.|:|:...:|  |||. ..|:.||.::||  .:..|.
Zfish   327 SSES-IYVSKALQKAKIEVNEDGTKASATTSVILHARS--SPPW-VTVDRPFLFLIRHNSSGTIL 387

  Fly   363 FQGHFVNP 370
            |.|....|
Zfish   388 FAGQINKP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 117/389 (30%)
serpine2NP_956478.1 PAI-1_nexin-1 26..395 CDD:239006 116/382 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.