DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinb3b

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_941373.1 Gene:Serpinb3b / 383548 MGIID:2683293 Length:387 Species:Mus musculus


Alignment Length:386 Identity:134/386 - (34%)
Similarity:220/386 - (56%) Gaps:39/386 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL-------------P 67
            :|..::|:.|  ..:|||:..||:|:..||::..:||:|.|..::..||:.             .
Mouse    10 KFAVEMYRQL--RESDKNIFYSPISMMTALAMLQLGAKGNTEIQIEKVLQFIETTKKTTEKSEHC 72

  Fly    68 DDKKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANN-P 131
            ||::.|..:|:.|:::|........|..||.||....|..:..:.:.:|:.::|:.|::...: .
Mouse    73 DDEENVHEQFQKLITQLNKSNDDYDLKAANSIYGAKGFPFLQTFLEDIKEYYQAKVESLDFEHAT 137

  Fly   132 KITASIVNKWVDTQTSGKIRDLVMPSD--VANLVLVILNAIYFKGQWQKKFNTEQTKSD-FHISD 193
            :.:...:|.||:::|:|||:|| .||.  .::.:||::||:||||||.:|||...|:.: |.::.
Mouse   138 EESEKKINSWVESKTNGKIKDL-FPSGSLSSSTILVLVNAVYFKGQWNRKFNENHTREEKFWLNK 201

  Fly   194 QKSVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGFTPKLI 258
            ..|.|||||.....|..|:..::.|.::|:||:..:|||.:.||.::|||.:||:::.  |.||:
Mouse   202 NTSKPVQMMKQRNKFNFSFLGDVHAQIVEIPYKGKDLSMFVLLPMEIDGLKQLEEQLT--TDKLL 264

  Fly   259 N----INVH-----LRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLVANSGAHVGGVVHK 313
            .    .|:|     |.||:||:|....|:..|..||:.||| ...|||:.:.:..|..|..|:||
Mouse   265 EWIKAENMHLTELYLSLPRFKVEEKYDLQVPLEHMGMVDAFDPQKADFSGMSSIPGLVVSKVLHK 329

  Fly   314 AFLEVNEEGSEAAAATAVVFRYKSIRSPPM--DFNVNHPFAYVI--RDAENIYFQGHFVNP 370
            :|:||||||:||||||.|..   |:||..:  ||..:|||.:.|  |...:|.|.|...:|
Mouse   330 SFVEVNEEGTEAAAATGVEV---SVRSAQIAEDFCCDHPFLFFIIHRMTNSILFFGRICSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 133/384 (35%)
Serpinb3bNP_941373.1 SERPIN 6..387 CDD:294093 133/384 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44055
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.