DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinb1c

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_006516771.1 Gene:Serpinb1c / 380839 MGIID:2445363 Length:408 Species:Mus musculus


Alignment Length:379 Identity:132/379 - (34%)
Similarity:209/379 - (55%) Gaps:27/379 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKKEVAA 75
            :|.:..|..:|:..|.:.|...|.|.||:|:..||::.|:||||.||.::...|.. |..:::.:
Mouse    38 SSANNLFALELFHTLNESNPTGNTIFSPVSISSALAMVYLGARGSTAAQLSKTLHF-DSAEDIHS 101

  Fly    76 KFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITA-SIVN 139
            :|:.|.:::..|.:...|.||||:|....:..:|||...::.::.|:...:...:....| ..:|
Mouse   102 QFQSLTAEVSKRGASHTLKLANRLYGEKTYNFLPEYLASIQKTYSADLALVDFQHASEDARKEIN 166

  Fly   140 KWVDTQTSGKIRDLVMPSDVANLV-LVILNAIYFKGQWQKKFNT-EQTKSDFHISDQKSVPVQMM 202
            :||..||..||::|.....|.::. ||::||.||||.|||||.. :.|.:.|.:|.:.:..|:||
Mouse   167 QWVKGQTEEKIQELFAVGVVDSMTKLVLVNATYFKGMWQKKFMARDTTDAPFRLSKKVTKTVKMM 231

  Fly   203 SLVR--PFGVSYDRELGANVIELPYRNSNLSMVIFLP----DKVDGLPELEKKM----VGFTPKL 257
            .|..  |||  |..:|...|:|:||:...|||||.||    |:..||.|:||::    :.....|
Mouse   232 YLKNNLPFG--YIPDLKCKVLEMPYQGGELSMVILLPEDIEDETTGLEEIEKQLTLEKLQECENL 294

  Fly   258 ININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTS-ADFNDLVANSGAHVGGVVHKAFLEVNEE 321
            .||:|.::|||||:|.|..|...|..:|:||.|.:| ||.:.:..:....:..:|||:::|||||
Mouse   295 QNIDVCVKLPKFKMEESYILNSNLGQLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSYVEVNEE 359

  Fly   322 GSEAAAA---TAVVFRYKSIRSPPMDFNVNHPFAYVIR--DAENIYFQGHFVNP 370
            |:|..||   |.|     .....||:|.|:|||.:.||  ...::.|.|...:|
Mouse   360 GTETDAAMPGTVV-----GCCLMPMEFTVDHPFLFFIRHNPTAHVLFLGRVCSP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 130/374 (35%)
Serpinb1cXP_006516771.1 serpinB1_LEI 34..408 CDD:381028 131/377 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44055
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.