DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and AT1G62160

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:177 Identity:60/177 - (33%)
Similarity:87/177 - (49%) Gaps:41/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 SYDRELGANVIELPYR------NSNLSMVIFLPDKVDGLPELEKKMV---GF----TPK-LININ 261
            :||   |..|:.||||      |.|.||..:||||...|.:|.|:|.   ||    ||: .:.::
plant    66 AYD---GFKVLRLPYRQGRDNTNRNFSMYFYLPDKKGELDDLLKRMTSTPGFLDSHTPRERVEVD 127

  Fly   262 VHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAA 326
             ..|:|||||||               .|:.|:.|:|...:...:     .||.:|::|||:|||
plant   128 -EFRIPKFKIEF---------------GFEASSVFSDFEIDVSFY-----QKALIEIDEEGTEAA 171

  Fly   327 AATAVVFRYKSIR-SPPMDFNVNHPFAYVIRDAE--NIYFQGHFVNP 370
            ||||.|....... ...:||..:|||.::||:.:  .:.|.|...:|
plant   172 AATAFVDNEDGCGFVETLDFVADHPFLFLIREEQTGTVLFAGQIFDP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 59/175 (34%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 59/175 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.