DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and AT1G62160

DIOPT Version :10

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:63 Identity:13/63 - (20%)
Similarity:27/63 - (42%) Gaps:21/63 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 DAWVVIKIQDPSYVYRWRLQAEIAMRQDGQAGMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSG 341
            |.|     :||.   .::.:..:::.:.||    ::|:.|...:|:|         :|.|..|
plant   406 DFW-----EDPD---EFKPERFLSISRSGQ----EDEIRDKFLKYIP---------FASGRRG 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 serpin42Dd-like_insects 12..370 CDD:381070 13/63 (21%)
AT1G62160NP_176407.2 serpin 1..218 CDD:476815
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.