DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina11

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001008776.1 Gene:Serpina11 / 362774 RGDID:1359239 Length:462 Species:Rattus norvegicus


Alignment Length:417 Identity:97/417 - (23%)
Similarity:183/417 - (43%) Gaps:65/417 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVL-----KLPDDK 70
            |.....|...||:.||:| ...|::.||:|:...::|..:||...|..::...|     :.|  .
  Rat    51 TPTITNFALRLYKQLAEE-IPGNILFSPVSLSSTVALLSLGAHADTQAQILQSLGFNLTETP--A 112

  Fly    71 KEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITA 135
            .::...|:.||..|:.......|.|.:.::::.:.|....:....|:.:.|.|.:.:......|.
  Rat   113 ADIHRGFQSLLHTLDLPSPKLELKLGHSLFLDRQLKPQQRFLDSAKELYGALAFSANFTEAAATG 177

  Fly   136 SIVNKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQTK--SDFHISDQKSVP 198
            ..:|..|..||.|::.. .:|....:.::|:||.|:||.:|:..|:..||:  ..|.:..:..:.
  Rat   178 QQINDLVRKQTYGQVVG-CLPEFDRDTLMVLLNYIFFKAKWKHPFDRYQTRKQESFFVDQRLQLR 241

  Fly   199 VQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVI-------------------------FLP- 237
            :.||.........||:|....|:::.|..:.|.:::                         ||| 
  Rat   242 IPMMRQKEMHRFLYDQEASCTVLQIEYSGTALLLLVLPDPGKMQQVEAALQPETLRRWGQRFLPR 306

  Fly   238 --------------DKVDGLPE-----LEKKMVGFTPKLININVHLRLPKFKIEFSARLEQVLIA 283
                          |:|:..|:     |..|.:..|.....:::|  ||:|.:..:..||::|..
  Rat   307 KAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHLQMTQTWSLLDLH--LPRFSVSATYNLEEILPL 369

  Fly   284 MGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIR---SPPMDF 345
            :|:...|...||.:.::......|..|.|||.:::||:|:|||||:.::.:..|:.   :|...|
  Rat   370 VGLSSLFDVEADLSGIMGQLNKTVSRVSHKAVVDMNEKGTEAAAASGLLSQPPSLNMTSAPHAHF 434

  Fly   346 NVNHPFAYVIRD--AENIYFQGHFVNP 370
              |.||..::.:  .:::.|.|..|||
  Rat   435 --NRPFLLLLWEVTTQSLLFLGKVVNP 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 94/412 (23%)
Serpina11NP_001008776.1 alpha-1-antitrypsin_like 53..456 CDD:239011 93/410 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.