DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and CG43366

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster


Alignment Length:326 Identity:74/326 - (22%)
Similarity:140/326 - (42%) Gaps:39/326 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKKEVAAK--FKDLLSKLE--GR 87
            |.::.::|:.||.::...||:.::||||.|:.||.::||| ||.......  ||::.:.:|  ..
  Fly  1701 KISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKL-DDMVTFNPHLIFKNITNSVEQASD 1764

  Fly    88 ESVAILSLANRIYVNN-KFKLVPEYNQMVKDSFKAEAEAISANNPKITASIV----NKWVDTQTS 147
            ..:|..:....|:.:. ..|::|.:.:..:..:....|.:   |..:...||    |..|...|.
  Fly  1765 SDIATAAFVREIFSDRANGKILPFFKEKTQQLYAGHVEEV---NFHVVNDIVRRRTNLLVKRHTM 1826

  Fly   148 GKIRDLVMPSDV-ANLVLVILNAIYFKGQWQKKFNTEQTKSDFH-----ISDQKSVPVQMMSLVR 206
            ||:.:.:..:.| .|..|..::|..|:........|::....|.     :..::.||:..:....
  Fly  1827 GKVLEYLRTNSVWVNGPLATISANLFQTDCSHGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRS 1891

  Fly   207 PFGVSYDRELGANVIELPYRNSNLSMVIFLP------DKVDGLPELEKKMV--GFTPK------L 257
            .|...|:..|.|.|:......:.:|.|..:|      ..:|.|..||:.:|  .|:.|      |
  Fly  1892 GFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMDNLDRLERSLVETAFSDKQAWRRLL 1956

  Fly   258 INI----NVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLEV 318
            .::    .:.::||:|...........|..||::..||  :||.||...:||....:.....:::
  Fly  1957 TSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFK--SDFADLRGLTGAGNRDIFLSDMIQI 2019

  Fly   319 N 319
            |
  Fly  2020 N 2020

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 74/326 (23%)
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 74/326 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.