DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and SERPINA9

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:375 Identity:107/375 - (28%)
Similarity:185/375 - (49%) Gaps:22/375 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMR-----DVLKLPDDKK 71
            |::..|...||:.|..|...:|:..||:||..:|::..:||...|..::.     ::...|:  .
Human    46 SLNTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPE--S 108

  Fly    72 EVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITAS 136
            .:...|:.|:..|........|.:.:.::|..:.:|...:...||..::||..:...:||.|..:
Human   109 AIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQA 173

  Fly   137 IVNKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQTKSDFH--ISDQKSVPV 199
            .:|..|..:|.||:.|::...|:.. .:|::|.|:||.:|:|.|:.|.|:.:|.  :.:|.:|.|
Human   174 RINSHVKKKTQGKVVDIIQGLDLLT-AMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHV 237

  Fly   200 QMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGFTPKLININVHL 264
            .||.....|....|.||...|:::.|:...::..: ||.| ..:.:||:.:...|.:..:.::..
Human   238 PMMHQKEQFAFGVDTELNCFVLQMDYKGDAVAFFV-LPSK-GKMRQLEQALSARTLRKWSHSLQK 300

  Fly   265 R-----LPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSE 324
            |     :|:|.|..|..||.:|..||||:.|..:|||:.:.......|....|||.|:|:|||:|
Human   301 RWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTE 365

  Fly   325 AAAATAVVFRYKSIRSPPMDFNV--NHPFAYVI--RDAENIYFQGHFVNP 370
            |.|||...|..:| :..|..|.|  |..|..:|  :..:.|.|.|...||
Human   366 ATAATTTKFIVRS-KDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 104/371 (28%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.