DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina1f

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001101524.1 Gene:Serpina1f / 314406 RGDID:1307899 Length:412 Species:Rattus norvegicus


Alignment Length:419 Identity:86/419 - (20%)
Similarity:190/419 - (45%) Gaps:74/419 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCLLLLATSV--------------SCR--------FTDDLYQLLAKENADKNLITSPLSVEIALS 46
            ||.||..|..              .||        .:..|::.:|:.:.:.|::.||:.|..|:|
  Rat    16 LCCLLPITKTKYEDLYEDPNIDPFQCRKVALTISNISITLFKEMAQLSVNGNILFSPIRVIAAIS 80

  Fly    47 LAYMGARGKTAQEMRDVLK-----LPDDKKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFK 106
            :..:||:|..::.:.::|:     ||:  .|:...|:.||..:...|.::.|...:.::::....
  Rat    81 MLSLGAKGNESKRILEILRLNKTGLPE--AEIHKCFRYLLRAIHQPEQLSPLKSGSGVFIHQDLT 143

  Fly   107 LVPEYNQMVKDSFKAEAEAISANNPKITASIVNKWVDTQTSGKIRDLV--MPSDVANLVLVILNA 169
            .|.::.:.||:.:.::..:|:..:.:...:.:|.::.|:::.:|:::|  :.:|.   .:.::|.
  Rat   144 PVDKFVEGVKNLYHSDIVSINFTDCRRAKTQINNYMMTKSNKEIKNIVKNLENDT---YMAVVNY 205

  Fly   170 IYFKGQWQKKFNTE-----QTKSDFHISDQKSVPVQMMSLVRPFGVSYDRELGANVIELPYRNSN 229
            |.    |..|.|::     ..:.|:|:....::.|.|:.:|....:....:|.:.|:......||
  Rat   206 II----WNAKINSDFGCRSVKQKDYHLEQGMTIKVPMIHIVDLNHLFRVEDLSSTVLVFTLLASN 266

  Fly   230 LSMVIFLPDKVDGLPELEKKMVGFTPKLININ-------VHLRLPKFKIEFSARLEQVLIAMGIQ 287
            .:....:|| :..:.::|:::.  .|....:.       |:|..|:..:..:..:|.::..:||.
  Rat   267 FTTYFIIPD-IGQMQKVEQRLT--YPHFRRMRRQSNLRMVNLETPELSLSETHDVESMMNLLGIT 328

  Fly   288 DAFKTSADFNDLVANSGAHVGGVVHKAF-------LEVNEEGSEAAAATAVVFRYKSIRSPPMDF 345
            ..|.     ||  |||.|.:...:.|:|       |.::::||:...:|.    :|:..|..:.:
  Rat   329 YVFN-----ND--ANSSAVMNDTLQKSFKMVSKVKLTIDDKGSKPGRSTC----FKNDGSVDVGY 382

  Fly   346 -NVNHPFAYVIRDAEN--IYFQGHFVNPE 371
             ..|.||...|:|..|  ..|.|..|||:
  Rat   383 VQFNRPFLIFIKDPTNDVPLFLGRVVNPK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 79/392 (20%)
Serpina1fNP_001101524.1 serpin 47..410 CDD:422956 77/385 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.