DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and RGD1562844

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001333297.1 Gene:RGD1562844 / 306892 RGDID:1562844 Length:296 Species:Rattus norvegicus


Alignment Length:275 Identity:90/275 - (32%)
Similarity:151/275 - (54%) Gaps:13/275 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAIS-ANNPKI 133
            |.::...|:.|..||...|....|.:||.|:|:...:::|.:.:.....:.:|.|.:| |...:.
  Rat    13 KGDIHRGFQLLFKKLNKSERYFSLRMANGIFVDKTCEVLPTFKESCLRFYNSEMEQLSFAEAAEE 77

  Fly   134 TASIVNKWVDTQTSGKIRDLVMPSDVANLV--LVILNAIYFKGQWQKKFNTEQTKS-DFHISDQK 195
            :...||.||..||.|||.:| :|.|..:..  ||::||:|.|..|.::|:...|:. .|.|:..:
  Rat    78 SRKHVNTWVSKQTEGKIPEL-LPDDSVDFQTRLVLVNALYLKATWGRQFDEGSTREMPFKINKNE 141

  Fly   196 SVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELE-----KKMVGFT- 254
            :.|||||.....|...|.:|:.|:::.:||:...|..::.|||:...:.::|     :|:..:| 
  Rat   142 TRPVQMMYQEGIFCYKYVKEVPASLLMIPYKGDELCFLVLLPDESVDISKVEEELTFEKLTAWTQ 206

  Fly   255 PKLIN-INVHLRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLVANSGAHVGGVVHKAFLE 317
            |..:: .:|.:.|||||:|....|:.:|..:||.||| :|.||.:.:.......|...|||:.:|
  Rat   207 PDTMSYTHVEVFLPKFKLEEDYDLKSLLQRLGIVDAFEETKADLSAMAPERNLCVSKFVHKSVVE 271

  Fly   318 VNEEGSEAAAATAVV 332
            |||:|:|||||.:.|
  Rat   272 VNEKGTEAAAAASSV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 90/275 (33%)
RGD1562844NP_001333297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm46144
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.