DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and RGD1564786

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:375 Identity:122/375 - (32%)
Similarity:201/375 - (53%) Gaps:28/375 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDK------KEVAA 75
            |...|:::|. |:..||:..|..|:..|||:..|||.|.||.::...:.|  ||      .:|..
  Rat    53 FAIKLFKVLG-EDISKNVFFSLPSISSALSMILMGANGTTASQICQAMSL--DKCNSIGGGDVHQ 114

  Fly    76 KFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANN-PKITASIVN 139
            .|..||:|:...::..:|..||.:::.:.|:::..:.......::||.|.:.... |:.:...:|
  Rat   115 HFLSLLTKVNKTDTRCMLRKANSVFIEDSFEILASFKDACHKLYEAEIEELDFKGAPEQSRQHIN 179

  Fly   140 KWVDTQTSGKIRDLVMPSDV-ANLVLVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKSVPVQMM 202
            .||..:|...||:|:.|..| :|..|.::|.|||||..:|.||...|:. .|.:|..:...||||
  Rat   180 TWVAKKTEDIIRELLPPCTVNSNTCLFLVNVIYFKGSLEKPFNKADTREMPFKVSMNEKKTVQMM 244

  Fly   203 SLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEK-----KMVGFTPK--LINI 260
            |....|.::|.:::...|:.||:.||.|||..|:||......:||.     |.:.:|.:  :...
  Rat   245 SQKSTFKMTYVKDISTQVLTLPFENSILSMYFFVPDSHVAQRKLENELTYDKFLEWTDEDTMEEK 309

  Fly   261 NVHLRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSE 324
            .:.:.||:.|:|.|..:..||..:|:.||| :..|||:.:.:..|..:..||||:|:|::|||:|
  Rat   310 EMEVFLPRIKLEESYDMNGVLRKLGMTDAFEEDKADFSGISSKHGLFLSKVVHKSFVEMSEEGTE 374

  Fly   325 AAAATAVVFRYKSIRSP--PMDFNVNHPFAYVIRD--AENIYFQGHFVNP 370
            |||.|.||    :::||  |.....:|||.:.|:|  ::.|.|.|.|.:|
  Rat   375 AAAPTDVV----TMKSPLTPRCLIADHPFLFSIQDTRSKEILFLGRFSSP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 121/373 (32%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 121/373 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.