DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and SERPIND1

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:378 Identity:103/378 - (27%)
Similarity:189/378 - (50%) Gaps:30/378 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VSCRFTDDLYQLLAKE-NADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPD-----DKK 71
            ::.:|..:||::|..: |...|:..:|:.:..|:.:..:|.:|:|.:::..:|...|     .|.
Human   129 LNAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDFVNASSKY 193

  Fly    72 EVAA---KFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKI 133
            |:..   .|:.|..:|..|.....|...|.:|:..:|.::.::...|::.:.|||:....::|..
Human   194 EITTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYFAEAQIADFSDPAF 258

  Fly   134 TASIVNKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKSV 197
             .|..|..:...|.|.|:|.:...|.|. .::|||.|||||.|..||..|.|.: :|.:::::.|
Human   259 -ISKTNNHIMKLTKGLIKDALENIDPAT-QMMILNCIYFKGSWVNKFPVEMTHNHNFRLNEREVV 321

  Fly   198 PVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGFTPKLI---- 258
            .|.||.....|..:.|:||..::::|.| ...:||:|.:|.|:.|:..||.::   ||:::    
Human   322 KVSMMQTKGNFLAANDQELDCDILQLEY-VGGISMLIVVPHKMSGMKTLEAQL---TPRVVERWQ 382

  Fly   259 ----NINVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLEVN 319
                |....:.|||||:|.:..|.:.|..|||:..|..:.:... :::....:....|:..:.||
Human   383 KSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDKNGNMAG-ISDQRIAIDLFKHQGTITVN 446

  Fly   320 EEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAEN--IYFQGHFVNP 370
            |||::|...|.|.|...|.:   :.|.|:.||.::|.:...  :.|.|...||
Human   447 EEGTQATTVTTVGFMPLSTQ---VRFTVDRPFLFLIYEHRTSCLLFMGRVANP 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 101/375 (27%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 103/378 (27%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.