DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinc1

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001012027.1 Gene:Serpinc1 / 304917 RGDID:1307404 Length:465 Species:Rattus norvegicus


Alignment Length:384 Identity:119/384 - (30%)
Similarity:198/384 - (51%) Gaps:30/384 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFTDDLYQLLA-KENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKKEVA 74
            :..:.||..:.||.|| .:|.:.|:..||||:..|.::..:||...|.:::.:|.|.....::.:
  Rat    85 SKANSRFATNFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNNTLKQLMEVFKFDTISEKTS 149

  Fly    75 AKFKDLLSKLEGR------ESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAIS-ANNPK 132
            .:.....:||..|      :|..::| |||::.:........|..:.:..:.|:.:.:. ..||:
  Rat   150 DQIHFFFAKLNCRLYRKANKSSNLVS-ANRLFGDKSLTFNESYQDVSEIVYGAKLQPLDFKENPE 213

  Fly   133 ITASIVNKWVDTQTSGKIRDLVMPSDVANL-VLVILNAIYFKGQWQKKFNTEQT-KSDFHISDQK 195
            .:...:|.||..:|.|:|:|::....:..| .||::|.|||||.|:.||:.|.| |..||..|.:
  Rat   214 QSRVTINNWVANKTEGRIKDVIPQGAIDELTALVLVNTIYFKGLWKSKFSPENTRKEPFHKVDGQ 278

  Fly   196 SVPVQMMSLVRPFGVSYDR-ELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGFTPKLI- 258
            |..|.||.....|  .|.| ..|..|:|:|::..:::||:.||.....|.::|:::   ||:|: 
  Rat   279 SCLVPMMYQEGKF--KYRRVGEGTQVLEMPFKGDDITMVLILPKPEKSLAKVEQEL---TPELLQ 338

  Fly   259 -------NINVHLRLPKFKIEFSARLEQVLIAMGIQDAFK-TSADFNDLVA--NSGAHVGGVVHK 313
                   .:.:.:.:|:|:||.|..|::.|..||:.|.|. ..:....::|  .....|....||
  Rat   339 EWLDELSEVMLVVHVPRFRIEDSFSLKEQLQDMGLVDLFSPEKSQLPGIIAEGRDDLFVSDAFHK 403

  Fly   314 AFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDA--ENIYFQGHFVNP 370
            ||||||||||||||:|:||...:|:....:.|..|.||..:||:.  ..|.|.|...||
  Rat   404 AFLEVNEEGSEAAASTSVVITGRSLNPSRVTFKANRPFLVLIREVALNTIIFMGRVSNP 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 117/379 (31%)
Serpinc1NP_001012027.1 antithrombin-III_like 80..459 CDD:239000 117/379 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.