DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and LOC299282

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001376144.2 Gene:LOC299282 / 299282 RGDID:3745 Length:413 Species:Rattus norvegicus


Alignment Length:382 Identity:127/382 - (33%)
Similarity:202/382 - (52%) Gaps:28/382 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLATSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL---PD 68
            |.||:| :..|...||:.||..|.|||::.||||:..||::..:||:..|.:|:.:.||.   ..
  Rat    43 LTLASS-NTDFALSLYKKLALRNPDKNVVFSPLSISAALTILSLGAKDSTMEEILEGLKFNLTEI 106

  Fly    69 DKKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKI 133
            .::|:...|..||.:|...|....::..:.::::.:..::.|:.:..:..::|||.......|..
  Rat   107 TEEEIHQGFGHLLQRLSQPEDQVEINTGSALFIDKEQPILSEFQEKTRALYQAEAFIADFKQPNE 171

  Fly   134 TASIVNKWVDTQTSGKIRDLVMPSDVANLV-LVILNAIYFKGQWQKKFNTEQT-KSDFHISDQKS 196
            ...::|.:|..||.|||.:|.  ||:.... :|::|.:.|||:|:..||...| :|:|::.:::|
  Rat   172 AKKLINDYVSNQTQGKIAELF--SDLEERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKRS 234

  Fly   197 VPVQMMSLVRPFGVSY--DRELGANVIELPYRNSNLSMVIFLPD-----KVDG--LPE-LEKKMV 251
            |.|.||. ::.....|  |.||..:|:||.| ..|.|.:..|||     :|:.  .|| |:|...
  Rat   235 VKVPMMK-IKEVTTPYVRDEELSCSVLELKY-TGNASALFILPDQGKMQQVESSLQPETLKKWKD 297

  Fly   252 GFTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFL 316
            ...|::||   .||:|||.|.....|::||..:||:..|...||.:.:......:|..|||||.|
  Rat   298 SLIPRIIN---DLRMPKFSISTDYSLKEVLPELGIKKVFSQQADLSRITGTKDLYVSQVVHKAVL 359

  Fly   317 EVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVI--RDAENIYFQGHFVNPE 371
            :|:|.|:||.|||.|.   ..||..|...|.|.||..||  .|:::|.|.....||:
  Rat   360 DVDETGTEATAATGVA---TVIRRQPRTLNFNRPFMVVITDMDSQSILFVAKITNPK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 121/372 (33%)
LOC299282NP_001376144.2 serpinA3_A1AC 36..413 CDD:381019 126/380 (33%)
RCL 365..389 11/26 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.