DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and LOC299277

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_008763124.2 Gene:LOC299277 / 299277 RGDID:1595900 Length:420 Species:Rattus norvegicus


Alignment Length:378 Identity:108/378 - (28%)
Similarity:180/378 - (47%) Gaps:28/378 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL---PDDKKEV 73
            |::..|...||:.||.:|.:||:..||||:..||:...:||:|.|.||:.:.||.   ...:.::
  Rat    49 SINTDFAFSLYKELALKNPNKNIAFSPLSISAALASLSLGAKGNTLQEILEGLKFNLTETTEIDI 113

  Fly    74 AAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITASIV 138
            ...::|||.:|........:|.||.::|....:::..:.:..|..::.|..|............:
  Rat   114 HQNYRDLLQRLSQPGGQGQISRANLLFVEKHLQILNGFKEKAKALYQTEVFATDFQQTCEARKFI 178

  Fly   139 NKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQT-KSDFHISDQKSVPVQMM 202
            |.:|..|:.|||:::|...: ....:|:||.:.|.|||...|:.:.| ...|.:..::.|.|.||
  Rat   179 NDYVMIQSQGKIKEMVTELE-ERTSIVMLNFLLFTGQWSVPFDPDDTFMGKFILDSRRPVKVLMM 242

  Fly   203 ---SLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPE----------LEKKMVGFT 254
               .|..|:  .:|.||...|:||.|:....:|.| |||:  |..|          |.|......
  Rat   243 KTEDLTTPY--FWDEELKCTVVELNYKGHGKAMFI-LPDQ--GKMEQVEASLHPGTLRKWTDSLK 302

  Fly   255 PKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLEVN 319
            |::|:   .|.||||.:..:.:||.:|..:||.|.|.|.||.:.:.......|..::|...|.:.
  Rat   303 PRIID---ELHLPKFSLSKTYKLENILPELGIMDVFNTQADLSGIAGAKDVRVSQMIHNTVLGMA 364

  Fly   320 EEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRD--AENIYFQGHFVNP 370
            |.|:||.|.|.|.:.::..:......|....|.|::.:  :|.|.|....:||
  Rat   365 ETGTEAEATTRVEYNFRPAKLNDTFVNFVRKFLYMVLEPNSELISFMRKVINP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 105/374 (28%)
LOC299277XP_008763124.2 serpinA3_A1AC 37..417 CDD:381019 106/376 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.