DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina3m

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001257911.1 Gene:Serpina3m / 299276 RGDID:735068 Length:419 Species:Rattus norvegicus


Alignment Length:382 Identity:125/382 - (32%)
Similarity:204/382 - (53%) Gaps:29/382 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL---PDD 69
            |...|::..|...||::||.:|.|||::.||||:..||::..:||:|.|.:|:.:||:.   ...
  Rat    45 LTLESINTDFAFSLYKMLALKNPDKNVVFSPLSISAALAIVSLGAKGNTLEEILEVLRFNLTESY 109

  Fly    70 KKEVAAKFKDLLSKL-EGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKI 133
            :.::...|..||.:| :..:.|.|:: .|.::::...:::.|:.:..:..::.||.......|::
  Rat   110 ETDIHQGFGHLLQRLSQPGDQVKIIT-GNALFIDKNLQVLAEFQEKTRALYQVEAFTADFQQPRV 173

  Fly   134 TASIVNKWVDTQTSGKIRDLVMP-SDVANLVLVILNAIYFKGQWQKKFNTEQT-KSDFHISDQKS 196
            |..::|.:|..||.|||::||.. .:..::|||  |.:.|:|:|:..|:.:.| :|:|::.:::|
  Rat   174 TEKLINDYVRNQTQGKIQELVSGLKERTSMVLV--NYLLFRGKWKVPFDPDYTFESEFYVDEKRS 236

  Fly   197 VPVQMM---SLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDK-----VDG--LPE-LEKKM 250
            |.|.||   .|..|:  ..|.||..:|:||.| ..|.|.:..||||     |:.  .|| |:|..
  Rat   237 VKVSMMKIEELTTPY--FRDEELSCSVLELKY-TGNSSALFILPDKGRMQQVEASLQPETLKKWK 298

  Fly   251 VGFTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAF 315
            ....|:.|:   .|.||:..|.....||:||..:||:|.|...||.:.:.......|..||||..
  Rat   299 DSLRPRKID---ELYLPRLSISTDYSLEEVLPELGIRDVFSQQADLSRITGAKDLSVSQVVHKVV 360

  Fly   316 LEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVI--RDAENIYFQGHFVNP 370
            |:|||.|:||||||......:|.| |||....|.||...:  ...:.|.|....:||
  Rat   361 LDVNETGTEAAAATGANLVPRSGR-PPMIVWFNRPFLIAVSHTHGQTILFMAKVINP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 121/374 (32%)
Serpina3mNP_001257911.1 SERPIN 56..416 CDD:214513 120/369 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.