DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina6

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:407 Identity:102/407 - (25%)
Similarity:180/407 - (44%) Gaps:56/407 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLCLLLLATS---------------------VSCRFTDDLYQLLAKENADKNLITSPLSVEIALS 46
            |.|||.|.||                     .:..|..:|||.|...|.|||.:.||:|:.:||:
  Rat     6 YTCLLWLCTSGLWTAQASTNESSNSHRGLAPTNVDFAFNLYQRLVALNPDKNTLISPVSISMALA 70

  Fly    47 LAYMGARGKTAQEMRDVLKLPDDKKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEY 111
            :..:|:....:.:..........:.|:...|:.|...|:..::...:::.|.:::..|.||...:
  Rat    71 MVSLGSAQTQSLQSLGFNLTETSEAEIHQSFQYLNYLLKQSDTGLEMNMGNAMFLLQKLKLKDSF 135

  Fly   112 NQMVKDSFKAEAEAISANNPKITASIVNKWVDTQTSGKIR----DLVMPSDVANLVLVILNAIYF 172
            ...||..:::||.||...:....:..:|:.|..:|.|||.    ||..|:.     .:::|.|:.
  Rat   136 LADVKQYYESEALAIDFEDWTKASQQINQHVKDKTQGKIEHVFSDLDSPAS-----FILVNYIFL 195

  Fly   173 KGQWQKKFNTEQTK-SDFHISDQKSVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFL 236
            :|.|:..|:.|.|: .||::::..:|.|.||......|...|......:|::.|..:..:..| |
  Rat   196 RGIWELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRDSVFPCQLIQMDYVGNGTAFFI-L 259

  Fly   237 PDK-----------VDGLPELEKKMVGFTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAF 290
            ||:           .|.:....|.|   ||:.:|    |.:|||.|..:..|:.:|..:.|:|..
  Rat   260 PDQGQMDTVIAALSRDTIDRWGKLM---TPRQVN----LYIPKFSISDTYDLKDMLEDLNIKDLL 317

  Fly   291 KTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVI 355
            ...:||:....:....: .:||||.|:: :||:....:|.....:  :||.|:|...|.||..::
  Rat   318 TNQSDFSGNTKDVPLTL-TMVHKAMLQL-DEGNVLPNSTNGAPLH--LRSEPLDIKFNKPFILLL 378

  Fly   356 RD--AENIYFQGHFVNP 370
            .|  ..:.......|||
  Rat   379 FDKFTWSSLMMSQVVNP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 93/373 (25%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 92/371 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.