DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinh1

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_058869.2 Gene:Serpinh1 / 29345 RGDID:69302 Length:417 Species:Rattus norvegicus


Alignment Length:381 Identity:100/381 - (26%)
Similarity:183/381 - (48%) Gaps:29/381 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ATSVSCRFTD---DLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVL---KLPD 68
            ||:::.|.|.   .|||.:||:.|.:|::.|||.|..:|.|..:|.:..||.:.:.||   ||.|
  Rat    39 ATTLAERSTGLAFSLYQAMAKDQAVENILLSPLVVASSLGLVSLGGKATTASQAKAVLSAEKLRD 103

  Fly    69 DKKEVAAKFKDLLSKLEGRESVAIL-SLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPK 132
            :  ||.....:||..|....:..:. .|.:|:|..:......::.:..|..:..|...|:..:.:
  Rat   104 E--EVHTGLGELLRSLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKR 166

  Fly   133 ITASIVNKWVDTQTSGKIRDL---VMPSDVANLVLVILNAIYFKGQWQKKFNTEQTKS-DFHISD 193
            .....:|:|....|.||:.::   |..:|.|.||    ||::||..|.:||:.:...: .|.::.
  Rat   167 SALQSINEWASQTTDGKLPEVTKDVERTDGALLV----NAMFFKPHWDEKFHHKMVDNRGFMVTR 227

  Fly   194 QKSVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEK-----KMVGF 253
            ..:|.|.||.....:....|.:....::|:|..:...|::|.:|..|:.|..|||     ::..:
  Rat   228 SYTVGVTMMHRTGLYNYYDDEKEKLQLVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKTW 292

  Fly   254 TPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLVANSGAHVGGVVHKAFLE 317
            ..|:....|.:.|||..:|.:..|::.|..:|:.:|. |..||.:.:......::..|.|....|
  Rat   293 MGKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFE 357

  Fly   318 VNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAE--NIYFQGHFVNPE 371
            .:.||:   .....::..:.:|||.: |..:|||.:::||.:  ::.|.|..|.|:
  Rat   358 WDTEGN---PFDQDIYGREELRSPKL-FYADHPFIFLVRDNQSGSLLFIGRLVRPK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 97/374 (26%)
Serpinh1NP_058869.2 serpinH1_CBP1 35..416 CDD:381003 100/381 (26%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.