DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinb8

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001099418.1 Gene:Serpinb8 / 288937 RGDID:1309833 Length:375 Species:Rattus norvegicus


Alignment Length:367 Identity:126/367 - (34%)
Similarity:202/367 - (55%) Gaps:15/367 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKKEVAAKFKDLL 81
            |...|.::|.:|:..:||...|:||..||::.|:||:|.||.:|..||.|..| .:|...|:.||
  Rat    11 FAISLLKILGEEDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSQVLGLSGD-GDVHQGFQTLL 74

  Fly    82 SKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAIS-ANNPKITASIVNKWVDTQ 145
            :::....:..:|..|.|::.......:..:.:..:..::|..|.:| ..:.:.....:|.||..:
  Rat    75 AEVNKSGTQYLLKSACRLFGEESCDFLSTFKESCQKFYQAGIEEMSFVKDTEGCRKRINDWVLEK 139

  Fly   146 TSGKIRDLVMPSDVANLV-LVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKSVPVQMMSLVRPF 208
            |.|||.:::.|..|..|. ||::||:||||:|:.:|:.:.|:. .|..:.::...||||.....|
  Rat   140 TEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQEEKKTVQMMFKHAKF 204

  Fly   209 GVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEK-----KMVGFT-PK-LININVHLRL 266
            .:::..|:.|.|:.|||....||||:.|||:...|..:||     |:..:| |: |....|.:..
  Rat   205 KMAHVDEVNAQVLALPYAEDELSMVVLLPDESSDLTVVEKALTYEKLRAWTNPETLTESKVQVFF 269

  Fly   267 PKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAAAATA 330
            |:.|:|.|..||.||.::|:.||| :|.|||:.:.:.....|..|.||.|:||||||:||||.||
  Rat   270 PRLKLEESYDLETVLQSLGMTDAFEETKADFSGMTSKKNVPVSKVAHKCFVEVNEEGTEAAATTA 334

  Fly   331 VVFRYKSIRSPPMDFNVNHPFAYVI--RDAENIYFQGHFVNP 370
            |:...:|.|..|. |..:.||.:.|  :...:|.|.|.|.:|
  Rat   335 VIRNTRSCRIEPR-FCADRPFLFFIWHQKTSSILFCGRFSSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 125/365 (34%)
Serpinb8NP_001099418.1 SERPIN 4..375 CDD:294093 125/365 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm46144
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.