DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinb10

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_714955.2 Gene:Serpinb10 / 266775 RGDID:628853 Length:397 Species:Rattus norvegicus


Alignment Length:401 Identity:135/401 - (33%)
Similarity:218/401 - (54%) Gaps:46/401 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL------- 66
            ||.|:: :|..:..:.||:....:|:..||..:..:|::.|:|.:|.||.:|..||..       
  Rat     4 LAVSIN-QFAVEFSKKLAESAEGRNIFFSPWGISTSLAMVYLGTKGTTAAQMSQVLHFGSIQDFK 67

  Fly    67 --PDDKK------------EVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKD 117
              ||.:|            |:.:.|:.|.:|:....:..:|.:||||||...:....:|.:.:|.
  Rat    68 FGPDSEKKRKMECHSGKSEEIQSDFQTLTAKILKHGNSYVLKIANRIYVEKTYLFHNKYLEDMKT 132

  Fly   118 SFKAEAEAISANNPKITASI---VNKWVDTQTSGKIRDLVMPSDVAN--LVLVILNAIYFKGQWQ 177
            .|.||.:  |.|..:.:..|   :|.||.:||.|||.:| :|.|..:  ..:|::||:||||.|:
  Rat   133 YFGAEPQ--SVNFVEASGQIRKEINSWVGSQTGGKIPNL-LPDDAVDNKTTMVLVNALYFKGTWE 194

  Fly   178 KKFNTEQ-TKSDFHISDQKSVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVD 241
            .:|:.:. |:..|.|:...|.||||||:.:...|.:..||....::|.|:|...|:::.||::|:
  Rat   195 HQFSVQNTTERPFRINKTTSKPVQMMSMKQSLQVFHIEELQTIGVQLHYQNREFSLLLLLPEEVE 259

  Fly   242 GLPELEK-----KMVGFT--PKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFND 298
            ||.:||:     |:..:|  ..:....|.|.|||||:|.|..|:..|..||:.||| :..|:|::
  Rat   260 GLKQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEESYDLQSALRDMGMTDAFNQGKANFSN 324

  Fly   299 LVANSGAHVGGVVHKAFLEVNEEGSEAAAATA--VVFRYKSIRSPPMDFNVNHPFAYVIRD--AE 359
            :.:.....:..|.||.|||:||||:||||.|.  |.||   |::|.::.|.:|||.::||.  ..
  Rat   325 MTSERNLFLSNVFHKTFLEINEEGTEAAAGTGSEVNFR---IKAPSIELNADHPFLFLIRHNVTN 386

  Fly   360 NIYFQGHFVNP 370
            .|.|.|.|.:|
  Rat   387 TILFYGRFYSP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 131/394 (33%)
Serpinb10NP_714955.2 SERPIN 4..397 CDD:294093 134/399 (34%)
Nuclear localization signal. /evidence=ECO:0000250 74..77 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm46144
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.