DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina4

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_659565.2 Gene:Serpina4 / 246328 RGDID:708581 Length:423 Species:Rattus norvegicus


Alignment Length:385 Identity:105/385 - (27%)
Similarity:197/385 - (51%) Gaps:39/385 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRD-------VLKLPDD 69
            |.:..|...||.|:|.:|::||:..||||:.::|::...||.|.|..::.:       .|.||  
  Rat    50 SGNANFAFRLYHLIASQNSEKNIFFSPLSISVSLAILSTGAGGDTQAQILEGLGFNLTKLSLP-- 112

  Fly    70 KKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKIT 134
              |:...|:.|...:....:...:|:.:.:.::...:::.|:...::.|:.::....:..:.:..
  Rat   113 --EIHEGFRSLQHTIARPFTEPQISVGSALILSQNLQILSEFVSAIETSYNSKVLHANFRDKEAA 175

  Fly   135 ASIVNKWVDTQTSGKIRDLVMPSDVA-NLVLVILNAIYFKGQWQKKF-NTEQTKSDFHISDQKSV 197
            ..::|.:|...|.|||::||  ||:: ::.:|::|.|:|:|.|:|.| ::..:.|||::.:...|
  Rat   176 VQLINNYVKQNTQGKIKNLV--SDLSPDVKMVLVNYIFFQGLWKKPFPSSRVSTSDFYVDENTVV 238

  Fly   198 PVQMMSLVR-PFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELE-----------KKM 250
            .:.||...: ......||.:...|:.:.||...::..| |||: ..:.|:|           |::
  Rat   239 KIPMMLQDKEDHWYLEDRRVPCTVLRMDYRGDAVAFFI-LPDQ-GKMNEVEQVLSPGMLLRWKRL 301

  Fly   251 VG---FTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVH 312
            :.   |..|||     |:||||.|..|..|:::|..:|.||.|..:|:|:::......::..|.|
  Rat   302 LQNRFFYRKLI-----LQLPKFSISNSYELDEILPDLGFQDLFTPNANFSNISKKEKLYLSKVFH 361

  Fly   313 KAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVI--RDAENIYFQGHFVNP 370
            |..|:|||.|::|||||.....:.|.:........|.||..::  ..:::|.|.|..|||
  Rat   362 KTVLDVNEVGTKAAAATGSFATFFSAQPKKRYLIFNRPFLVILYSTSSQDILFMGKVVNP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 102/381 (27%)
Serpina4NP_659565.2 SERPIN 52..418 CDD:294093 101/378 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.