DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinb10

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:269 Identity:85/269 - (31%)
Similarity:141/269 - (52%) Gaps:37/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LAYMGARGKTAQEMRDVLKL---------PDDKK------------EVAAKFKDLLSKLEGRESV 90
            :.|:|.:|.||.:|..||:.         ||.:|            |:.:.|:.|.:::....:.
Mouse     1 MVYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDFQTLAAEILKPGNS 65

  Fly    91 AILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITASI---VNKWVDTQTSGKIRD 152
            .:|..|||||....:....:|.:.:|..|.||.:  |.|..:.:..|   :|.||.:||.|||.:
Mouse    66 YVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQ--SVNFVEASGQIRKEINSWVGSQTGGKIPN 128

  Fly   153 LVMPSDVAN--LVLVILNAIYFKGQWQKKFNTEQ-TKSDFHISDQKSVPVQMMSLVRPFGVSYDR 214
            | :|.|..:  ..:|::||:||||.|:.:|:.:. |:..|.::...|.||||||:.:...|.:..
Mouse   129 L-LPDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSKPVQMMSMKQSLQVFHIE 192

  Fly   215 ELGANVIELPYRNSNLSMVIFLPDKVDGLPELEK-----KMVGFT--PKLININVHLRLPKFKIE 272
            ||....::|.|:|.:||:::.||:.:|||.:||:     |:..:|  ..:....|.|.|||||:|
Mouse   193 ELQTIGLQLHYQNRDLSLLLLLPEAIDGLEQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKME 257

  Fly   273 FSARLEQVL 281
            .|..|:..|
Mouse   258 ESYDLKSAL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 85/269 (32%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 85/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2692
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44055
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.