DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinb13

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_766440.2 Gene:Serpinb13 / 241196 MGIID:3042250 Length:389 Species:Mus musculus


Alignment Length:389 Identity:123/389 - (31%)
Similarity:213/389 - (54%) Gaps:35/389 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVL---------KLP 67
            :.:.:|..||::.|.|.| |.|:..||:.:..|:.:..:|.||.||.|::.||         ::.
Mouse     6 TAATQFLFDLFKELNKTN-DGNVFFSPVGISTAIGMIILGTRGATASELQKVLYTEQGTESSRIK 69

  Fly    68 DDKKEVAAK------FKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAI 126
            .:::|:..:      .:.||:::....:...|.::||::....:..:.:|...|:..:.|..|.:
Mouse    70 SEEEEIEKREEIHHQLQMLLTEISKFSNDYDLIISNRLFGEKTYLFLQKYIDYVEKYYHASLEPV 134

  Fly   127 S-ANNPKITASIVNKWVDTQTSGKIRDLVMPSDV-ANLVLVILNAIYFKGQWQKKFNTEQTK-SD 188
            . .|....:...:|.||::||:.|::||.....: ::..||::|.:||||.|.::|..|.|| .|
Mouse   135 DFVNAADESRKKINSWVESQTNVKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEED 199

  Fly   189 FHISDQKSVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGF 253
            |.::...|.|||||:|...|..::..:|.|.::.:||:|:::||.:.||:.:|||.::..||   
Mouse   200 FWLNKNLSKPVQMMALCSSFNFTFLEDLQAKIVGIPYKNNDISMFVLLPNDIDGLEKIMDKM--- 261

  Fly   254 TP-KLI---------NINVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVG 308
            :| ||:         ...|.||||:.::|.:..||.||.|:||..||...||::.:.|.||.|..
Mouse   262 SPEKLVEWTSPGHLEQRRVDLRLPRLQVEETYDLEPVLEAVGIHSAFSEHADYSGMSARSGLHAQ 326

  Fly   309 GVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVI--RDAENIYFQGHFVNP 370
            ..:|::||.|.|||.||.|.|.|..:..|..|..: .:.||||.:.|  |::::|.|.|.|.:|
Mouse   327 NFLHRSFLVVTEEGVEATAGTGVGLKVSSAASCEL-VHCNHPFLFFIRHRESDSILFFGKFSSP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 122/385 (32%)
Serpinb13NP_766440.2 SERPIN 4..389 CDD:294093 122/387 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2692
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44055
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.