DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina3j

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001094942.1 Gene:Serpina3j / 238395 MGIID:2182843 Length:420 Species:Mus musculus


Alignment Length:381 Identity:113/381 - (29%)
Similarity:187/381 - (49%) Gaps:26/381 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL---PDD 69
            |...|::..|...||:.||.:|..||.:.||||:.|||:...:||:|.|.:|:.:.||.   ...
Mouse    45 LTLASINTDFAFSLYKKLALKNPHKNFVFSPLSITIALASLSLGAKGNTLEEILEGLKFNLTETP 109

  Fly    70 KKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKIT 134
            :.::...|..||.:|........:|..|.:.|....:::.|:.:..:..:..|........|:..
Mouse   110 EADIHQGFGHLLQRLSQPGDQVQISTGNSMVVEKHLQILAEFKEKARALYHTEVFTADFQQPREA 174

  Fly   135 ASIVNKWVDTQTSGKIRDLVMPSDVANLV-LVILNAIYFKGQWQKKFNTEQTKSDFHISDQKS-V 197
            ..::|.:|..||.|.|::||  ||:.... :|:.|...|.|:|...|:..:|.....|.|::: |
Mouse   175 RKLLNDYVSNQTQGMIKELV--SDLEERTSMVMTNFALFNGKWNMTFDPYETFMGTFIEDRRTPV 237

  Fly   198 PVQMMSLVRPFGVSY--DRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGFT------ 254
            .|.||.: :.....|  |.::...|:||.|:.:..:|.| |||: ..:.::|..:...|      
Mouse   238 KVSMMKM-KELRAPYFRDEKMKCTVVELNYKGNGKAMFI-LPDQ-GKMKQVEASLQPATLRGWRK 299

  Fly   255 ---PKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFL 316
               |::|:   .|.||||.|..:.|||.:|..:||::.|.|.||.:.:.......|..:.|.|.|
Mouse   300 SLRPRMID---ELYLPKFSISKNYRLENILPELGIKEVFSTQADLSGISGGKDVRVSRMFHSAAL 361

  Fly   317 EVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVI--RDAENIYFQGHFVNP 370
            ::.|.|:||.|.|...:.:.|.:|.|...|:|.||.:.:  .|:|||.|.|...||
Mouse   362 DMTETGTEARATTRDKYDFLSTKSNPTVVNLNTPFLFCVLHSDSENIDFMGKINNP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 109/373 (29%)
Serpina3jNP_001094942.1 serpinA3_A1AC 37..417 CDD:381019 111/379 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.