DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinb6a

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001157589.1 Gene:Serpinb6a / 20719 MGIID:103123 Length:399 Species:Mus musculus


Alignment Length:372 Identity:130/372 - (34%)
Similarity:207/372 - (55%) Gaps:22/372 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDK------KEVAA 75
            |..:|.::|. |::.||:..||:|:..||::.:|||:|.||.:|...|.|  ||      .:|..
Mouse    32 FALNLLKILG-EDSSKNVFLSPMSISSALAMVFMGAKGTTASQMAQALAL--DKCSGNGGGDVHQ 93

  Fly    76 KFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANN-PKITASIVN 139
            .|:.||:::....:..:|..|||::.:....|:..:.......::||.|.:.... .:.:...:|
Mouse    94 GFQSLLTEVNKTGTQYLLRTANRLFGDKTCDLLASFKDSCLKFYEAELEELDFQGATEESRQHIN 158

  Fly   140 KWVDTQTSGKIRDLVMPSDV-ANLVLVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKSVPVQMM 202
            .||..:|..||::::.|..| ::..||::|||||||.|:|:||.|.|:. .|.:|..:..|||||
Mouse   159 TWVAKKTEDKIKEVLSPGTVNSDTSLVLVNAIYFKGNWEKQFNKEHTREMPFKVSKNEEKPVQMM 223

  Fly   203 SLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEK-----KMVGFT--PKLINI 260
            .....|.::|..|:...::.|||.:|.|:|:|.|||:...|..:||     |.:.:|  .|:...
Mouse   224 FKKSTFKMTYIGEIFTKILLLPYVSSELNMIIMLPDEHVELSTVEKEVTYEKFIEWTRLDKMDEE 288

  Fly   261 NVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSEA 325
            .|.:.|||||:|.:..:...|..:|:.|||...|||:.:.:..|..:..||||||:||||||:||
Mouse   289 EVEVFLPKFKLEENYNMNDALYKLGMTDAFGGRADFSGMSSKQGLFLSKVVHKAFVEVNEEGTEA 353

  Fly   326 AAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAE--NIYFQGHFVNP 370
            |||||.:...:.:|..|. |..:|||.:.|...:  .|.|.|.|.:|
Mouse   354 AAATAGMMTVRCMRFTPR-FCADHPFLFFIHHVKTNGILFCGRFSSP 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 129/370 (35%)
Serpinb6aNP_001157589.1 SERPIN 25..399 CDD:294093 129/370 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44055
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.