DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina3m

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_033279.2 Gene:Serpina3m / 20717 MGIID:98378 Length:418 Species:Mus musculus


Alignment Length:389 Identity:120/389 - (30%)
Similarity:195/389 - (50%) Gaps:40/389 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL---PDD 69
            |...|::..|...||:.:|.:|.|||::.||||:..||:|..:||:|.|.:|:.:.||.   ...
Mouse    45 LTLASINTDFAFSLYKKMALKNPDKNIVFSPLSISAALALVSLGAKGNTLEEILEGLKFNLTETS 109

  Fly    70 KKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKIT 134
            :.::...|..||.:|...|....:::.|.:::....:::.|:::..:..::.||.......|...
Mouse   110 EADIHQGFGHLLQRLSQPEDQDQINIGNAMFIEKDLQILAEFHEKTRALYQTEAFTADFQQPTEA 174

  Fly   135 ASIVNKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQT-KSDFHISDQKSVP 198
            ..::|.:|..||.|.|:.|:...|...| :|::|.|||||:|:..|:.:.| :|:|::.:::||.
Mouse   175 TKLINDYVSNQTQGMIKKLISELDDRTL-MVLVNYIYFKGKWKISFDPQDTFESEFYLDEKRSVK 238

  Fly   199 VQMMSL----VRPFGVSYDRELGANVIELPYRNSNLSMVIFLPD-----KVDG--LPE------- 245
            |.||.:    .|.|   .|.||..:|:||.| ..|.|.:..|||     :|:.  .||       
Mouse   239 VPMMKMKFLTTRHF---RDEELSCSVLELKY-TGNASALFILPDQGRMQQVEASLQPETLRKWWK 299

  Fly   246 -LEKKMVGFTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGG 309
             |:.:.:|          .|.||||.|.....|:.:|..:||::.|...||.:.:.......|..
Mouse   300 SLKTRKIG----------ELYLPKFSISTDYNLKDILPELGIKEIFSKQADLSGITGTKDLSVSQ 354

  Fly   310 VVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVI--RDAENIYFQGHFVNPE 371
            |||||.|:|.|.|:||||||..:|.::|.|...|....|.||..||  ...:...|.....||:
Mouse   355 VVHKAVLDVAETGTEAAAATGFIFGFRSRRLQTMTVQFNRPFLMVISHTGVQTTLFMAKVTNPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 116/380 (31%)
Serpina3mNP_033279.2 SERPIN 56..417 CDD:214513 115/375 (31%)
RCL 367..392 11/24 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.