DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina3n

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:381 Identity:126/381 - (33%)
Similarity:194/381 - (50%) Gaps:24/381 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL---PDD 69
            |...|::..|...||:.|..:|.|||::.||||:..||::..:||:|.|.:|:.:.||.   ...
Mouse    45 LTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETS 109

  Fly    70 KKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKIT 134
            :.::...|..||.:|...:....:|..:.:::..:.:::.|:.:..:..::|||.......|:..
Mouse   110 EADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKARALYQAEAFTADFQQPRQA 174

  Fly   135 ASIVNKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQT-KSDFHISDQKSVP 198
            ..::|.:|..||.|.|::||...|...| :|::|.||||.:|:..|:...| ||:|:...::.|.
Mouse   175 KKLINDYVRKQTQGMIKELVSDLDKRTL-MVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVI 238

  Fly   199 VQMMS---LVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPD-----KVDG--LPE-LEKKMVG 252
            |.|||   |..|:  ..|.||...|:||.| ..|.|.:..|||     :|:.  .|| |.|....
Mouse   239 VPMMSMEDLTTPY--FRDEELFCTVVELKY-TGNASAMFILPDQGKMQQVEASLQPETLRKWKNS 300

  Fly   253 FTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLE 317
            ..|::|:   .|.||||.|.....||.||..:||::.|.|.||.:.:.......|..|||||.|:
Mouse   301 LKPRMID---ELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLD 362

  Fly   318 VNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAEN--IYFQGHFVNPE 371
            |.|.|:||||||.|.|...|.:..|:....|.||..:|.|.|.  ..|.....||:
Mouse   363 VAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 122/372 (33%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 125/379 (33%)
RCL 367..392 11/24 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.