DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinb9b

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_035582.1 Gene:Serpinb9b / 20706 MGIID:894668 Length:377 Species:Mus musculus


Alignment Length:375 Identity:118/375 - (31%)
Similarity:197/375 - (52%) Gaps:29/375 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKKE--VAAKFKD 79
            |...|.::|.:.|..||:..||:|:..||::..:||:.:||.::...|.|   |||  :...|..
Mouse    11 FAIHLLKMLCQSNPSKNVCFSPVSISSALAMVLLGAKEQTAVQISQALGL---KKEKGIHQGFLK 72

  Fly    80 LLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKI-TASIVNKWVD 143
            ||.||...:....|.:|||::.:...:::..:.:.....:.:|.|.::.....: :...:|.||.
Mouse    73 LLRKLNKPDRKYSLIVANRLFADKTCEVLQTFKESCFRFYDSEMEQVNFFKAAVESRQCINTWVS 137

  Fly   144 TQTSGKIRDLVMPSDVANLV--LVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKSVPVQMMSLV 205
            .||.|||.:| :..|..|..  ||::||:||||.|..:|..|.|:. .|:|:..:..|||||...
Mouse   138 KQTEGKIPEL-LADDSVNFQTRLVLVNALYFKGMWACQFCKESTREMPFYINKDEKRPVQMMCQT 201

  Fly   206 RPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELE-----KKMVGFT-PKLI-NINVH 263
            ..|..::..||.|.::.:||....||:::.||:|...|.::|     :|::.:| |.:: :..|.
Mouse   202 DTFMFAFVDELPARLLIMPYEGMELSLMVLLPEKGVDLSKVENDLTFEKLIAWTKPDIMWSTEVK 266

  Fly   264 LRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAAA 327
            :.|||||::....::.||..:||.|.| |..||.:.:.......:...:||:.:||||||:||||
Mouse   267 VFLPKFKLQEDYEMKSVLQCLGIVDVFEKEKADLSAMSPERNLCLSKFIHKSVVEVNEEGTEAAA 331

  Fly   328 ATAVVFRYKSI-----RSPPMDFNVNHPFAYVIR--DAENIYFQGHFVNP 370
            |::.    :.|     ...|..|..:|||.:.||  ...:|.|.|.|.:|
Mouse   332 ASSA----EGIIPLCLGGGPSWFCADHPFLFFIRHNQTNSILFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 117/373 (31%)
Serpinb9bNP_035582.1 SERPIN 4..377 CDD:294093 117/373 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44055
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.