DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina1b

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_033270.3 Gene:Serpina1b / 20701 MGIID:891970 Length:413 Species:Mus musculus


Alignment Length:375 Identity:108/375 - (28%)
Similarity:192/375 - (51%) Gaps:21/375 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL---PDDK 70
            :||::. .|...||:.|..::...|:..||:|:..|.::..:|::|.|..::.:.|:.   ...:
Mouse    44 IATNLG-DFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSE 107

  Fly    71 KEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITA 135
            .::...|:.||..|...:|...||..|.::|||..|||.::.:..|:.::||..:::....:...
Mouse   108 ADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAK 172

  Fly   136 SIVNKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQT-KSDFHISDQKSVPV 199
            .::|.:|:..|.|||.:.|...| .:.|..:.|.|.|||:|:|.|:.|.| :::||:....:|.|
Mouse   173 KVINDFVEKGTQGKIVEAVKELD-QDTVFALANYILFKGKWKKPFDPENTEEAEFHVDKSTTVKV 236

  Fly   200 QMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPD--KVDGLPE-LEKKMVGFTPKLININ 261
            .||.|.....|.:...|.:.|:.:.|. .|.|.|..||:  |:..|.: |.|:::  :..|:|..
Mouse   237 PMMMLSGMLDVHHCSILSSWVLLMDYA-GNASAVFLLPEDGKMQHLEQTLNKELI--SKILLNRR 298

  Fly   262 ---VHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLV-ANSGAHVGGVVHKAFLEVNEEG 322
               |.:.:|:..|.....|:.::..:||...|...||.:.:. .|:...:...||||.|.::|.|
Mouse   299 RRLVQIHIPRLSISGDYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSKAVHKAVLTIDETG 363

  Fly   323 SEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVI--RDAENIYFQGHFVNP 370
            :||||||  ||....:..||: ...:|||.::|  ...::..|.|..|:|
Mouse   364 TEAAAAT--VFEAVPMSMPPI-LRFDHPFLFIIFEEHTQSPIFVGKVVDP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 105/368 (29%)
Serpina1bNP_033270.3 SERPIN 53..410 CDD:214513 104/363 (29%)
RCL 368..387 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.