DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and SERPINB1

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_109591.1 Gene:SERPINB1 / 1992 HGNCID:3311 Length:379 Species:Homo sapiens


Alignment Length:379 Identity:133/379 - (35%)
Similarity:214/379 - (56%) Gaps:23/379 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDDKKEVAA 75
            :|.:.||..||:..|::.|...|:..||.|:..|:::.::|.||.||.::...... :..:||.:
Human     5 SSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHF-NTVEEVHS 68

  Fly    76 KFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITA-SIVN 139
            :|:.|.:.:..|.:..||.||||:|....:..:||:....:.::.|:..::...:....| ..:|
Human    69 RFQSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTIN 133

  Fly   140 KWVDTQTSGKIRDLVMPSDVANLV-LVILNAIYFKGQWQKKFNTE-QTKSDFHISDQKSVPVQMM 202
            :||..||.|||.:|:....|.|:. ||::|||||||.|:.||..| .|.:.|.::.:....|:||
Human   134 QWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMM 198

  Fly   203 SLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVD----GLPELE-----KKMVGFT-PKL 257
            ...:.|...|..:|...|:||||:...|||||.|||.::    ||.::|     :|:..:| |:.
Human   199 YQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPEN 263

  Fly   258 IN-INVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAH---VGGVVHKAFLEV 318
            :: |.|::.||:||:|.|..|...|..:|:||.|.:|.  .||...|||.   :..:|||:|:||
Human   264 LDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSK--ADLSGMSGARDIFISKIVHKSFVEV 326

  Fly   319 NEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIR--DAENIYFQGHFVNP 370
            ||||:|||||||.:..: .:..|..:|..:|||.:.||  .:.:|.|.|.|.:|
Human   327 NEEGTEAAAATAGIATF-CMLMPEENFTADHPFLFFIRHNSSGSILFLGRFSSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 131/374 (35%)
SERPINB1NP_109591.1 SERPIN 4..379 CDD:294093 132/377 (35%)
CARD-binding motif (CBM). /evidence=ECO:0000269|PubMed:30692621 351..379 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10598
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.