DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpina16

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_112098.3 Gene:Serpina16 / 194604 MGIID:2684892 Length:440 Species:Mus musculus


Alignment Length:411 Identity:102/411 - (24%)
Similarity:172/411 - (41%) Gaps:60/411 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLATSVSC------------------------------RFTDDLYQLLAKENADKNLITSPLSV 41
            ||||..|.|                              :|...||..|.|....||:|.||||:
Mouse    32 LLLAVLVPCFGGPVTPPTETSNTSRTPAIQGAPPFFNNQKFALSLYTQLPKSKLGKNVIFSPLSI 96

  Fly    42 EIAL-SLAYMG---ARGKTAQEMRDVLKLPDDKKEVAAKFKDLLSKLEGRESVAILSLANRIYVN 102
            .:.| .||:..   ||.:..|.:...:....|.| .|.::..|||.|...|...| ...:..:::
Mouse    97 TMPLVLLAFQDKPEARRQVLQGLGFGVTGALDAK-AAVQYGKLLSALLPAEHCGI-HTGSLFFID 159

  Fly   103 NKFKLVPEYNQMVKDSFKAEAEAISANNPKITASIVNKWVDTQTSGKI----RDLVMPSDVANLV 163
            ...|....:..:...|:.::...||..|.|:....::..:..:|.||:    |:|..|:.     
Mouse   160 KTLKPQTTFLTLANSSYSSDVILISFGNHKLAKKQIDLAIKVKTQGKVTRLLRNLKPPTH----- 219

  Fly   164 LVILNAIYFKGQWQKKFNTEQT-KSDFHISDQKSVPVQMMSLVRPFGVSYDRELGANVIELPYRN 227
            |.:.|...|||:|:.:||.:.| ..:|.:|:..::.|.||..:..|.:.|...:.:.|::||: .
Mouse   220 LFLTNYNLFKGKWKYRFNPKYTGMRNFSLSNGTNILVPMMQKIGWFQLKYFSHIHSYVLQLPF-T 283

  Fly   228 SNLSMVIFLPDKVDGLPELEKKMV--GFTPKLININVHLR---LPKFKIEFSARLEQVLIAMGIQ 287
            .|:|.|.|||:..| |.|.||.::  .|...:....:..|   .|||.|..:.:||.........
Mouse   284 CNISGVFFLPNDGD-LKECEKALLEQSFNTWIQPFPLRKRWLFFPKFSIPVALQLESFKHVNSSL 347

  Fly   288 DAFKTSADFNDL-VANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPF 351
            ..|....|.:.: :..:...|...||:|.|.|:|:|.....:.:.|.....:.:    .:.|..|
Mouse   348 KLFNKRMDLSGITLQKAPLRVTMAVHRAELAVSEDGEGEDVSNSRVNPEPGLAA----LHFNRSF 408

  Fly   352 AYVIRD--AENIYFQGHFVNP 370
            ..:|.|  ::::.|.|..:||
Mouse   409 LLLILDEASKSLLFMGRVLNP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 95/402 (24%)
Serpina16XP_112098.3 serpin 61..431 CDD:393296 96/382 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.