DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpind1

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001317976.1 Gene:Serpind1 / 15160 MGIID:96051 Length:478 Species:Mus musculus


Alignment Length:379 Identity:110/379 - (29%)
Similarity:194/379 - (51%) Gaps:32/379 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VSCRFTDDLYQLLAKENA--DKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPD-----DK 70
            ::.:|..:||::| |:.|  ..||..:|:.:..|:.:..:|.||:|.:|:..||...|     .|
Mouse   108 LNAKFAFNLYRVL-KDQATTSDNLFIAPVGISTAMGMISLGLRGETHEEVHSVLHFRDFVNASSK 171

  Fly    71 KEVAA---KFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPK 132
            .||..   .|:.|..:|..|.....|...|.:|:..:|.:..::...:::.:.|||:..:..:|.
Mouse   172 YEVTTIHNLFRKLTHRLFRRNFGYTLRSVNGLYIQKQFPIREDFKAAMREFYFAEAQEANFPDPA 236

  Fly   133 ITASIVNKWVDTQTSGKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKS 196
            . .|..|..:...|.|.|::.:...|.|..:| |||.|||||.|..||..|.|.: :|.:::::.
Mouse   237 F-ISKANNHILKLTKGLIKEALENIDPATQML-ILNCIYFKGTWVNKFPVEMTHNHNFRLNEREV 299

  Fly   197 VPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVGFTPKLI--- 258
            |.|.||.....|..:.|:||..::::|.| ...:||:|.:|.|:.|:..||.::   ||:::   
Mouse   300 VKVSMMQTKGNFLAANDQELDCDILQLEY-VGGISMLIVVPRKLSGMKTLEAQL---TPQVVERW 360

  Fly   259 -----NINVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLEV 318
                 |....:.|||||:|.:..|.:||.:|||...|..:.:.:. :::....:....|::.:.|
Mouse   361 QKSMTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSG-ISDQRIAIDLFKHQSTITV 424

  Fly   319 NEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAEN--IYFQGHFVNP 370
            ||||::|||.|.|.|...|.:   :.|.|:.||.:::.:...  :.|.|...||
Mouse   425 NEEGTQAAAVTTVGFMPLSTQ---VRFTVDRPFLFLVYEHRTSCLLFMGKVTNP 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 108/376 (29%)
Serpind1NP_001317976.1 HCII 43..476 CDD:239002 110/379 (29%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 54..78
Glycosaminoglycan-binding site. /evidence=ECO:0000250 171..191 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.