DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and SERPINA12

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:369 Identity:93/369 - (25%)
Similarity:184/369 - (49%) Gaps:35/369 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMR---DVLKLPDDKKEVAAKFKDLLS 82
            |.:.||..|..:|:..||||:..|.|:..:||:..|..|::   :..|:|:  |::...|..::.
Human    59 LLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPE--KDLHEGFHYIIH 121

  Fly    83 KLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITASIVNKWVDTQTS 147
            :|..:.....||:.|.::::.:.:...::.:..|:.:.||....:..|.::....:|.::..:|.
Human   122 ELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTH 186

  Fly   148 GKIRDLVMPSDVANLVLVILNAIYFKGQWQKKFNTEQTK-SDFHISDQKSVPVQMMSLVRPFGVS 211
            |||.:|:...| ...|:::.|.|:|:.:|:.:|:...|| .||.:....||.|.||.....:.|.
Human   187 GKINNLIENID-PGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVG 250

  Fly   212 YDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKM---------VGFTPKLININVHLRLP 267
            ||.:|...::|:||: .|::.:..|||: ..|..|||.:         ...:.::::::|    |
Human   251 YDDKLSCTILEIPYQ-KNITAIFILPDE-GKLKHLEKGLQVDTFSRWKTLLSRRVVDVSV----P 309

  Fly   268 KFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAAAATAVV 332
            :..:..:..|::.|..:|:...|:...|...:..:....||..||||.|:::|.|:|.||.|.. 
Human   310 RLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGA- 373

  Fly   333 FRYKSIRSPPMD----FNVNHPFAYVIRDAE--NIYFQGHFVNP 370
                  ::.||:    ..::.|:..:|...:  ::.|.|..|||
Human   374 ------QTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 91/367 (25%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 91/367 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.